BGC0000549 - 1 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

BGC0000549 (Streptococcus salivarius)

Region	Type	From	To	Most similar known cluster		Similarity
Region 1	lanthipeptide-class-i	1	15,313	nisin Q	RiPP:Lanthipeptide	81%

BGC0000549 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 1 - 15,313 nt. (total: 15,313 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG

MIBiG comparison

KnownClusterBlast

Lanthipeptides

External annotation

Name		MIBiG
Version		3.0

Type		Subregion
Location		1 - 15,314
Label		BGC0000549

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000549.1	1.00	RiPP	salivaricin D	Streptococcus salivarius
BGC0000538.1	0.37	RiPP	nisin Z	Lactococcus lactis
BGC0000536.1	0.36	RiPP	nisin Q	Lactococcus lactis
BGC0000535.1	0.36	RiPP	nisin A	Lactococcus lactis subsp. lactis
BGC0001789.1	0.31	RiPP	suicin 90-1330	Streptococcus suis
BGC0000537.1	0.31	RiPP	nisin U	Streptococcus uberis
BGC0000560.1	0.28	RiPP	subtilomycin	Bacillus subtilis
BGC0000528.1	0.25	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000563.1	0.24	RiPP	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000502.1	0.24	RiPP	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000549.1	1.00	RiPP	salivaricin D	Streptococcus salivarius
BGC0000538.1	0.69	RiPP	nisin Z	Lactococcus lactis
BGC0000536.1	0.69	RiPP	nisin Q	Lactococcus lactis
BGC0000535.1	0.69	RiPP	nisin A	Lactococcus lactis subsp. lactis
BGC0001789.1	0.64	RiPP	suicin 90-1330	Streptococcus suis
BGC0000537.1	0.64	RiPP	nisin U	Streptococcus uberis
BGC0000560.1	0.61	RiPP	subtilomycin	Bacillus subtilis
BGC0000528.1	0.59	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000563.1	0.57	RiPP	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000502.1	0.57	RiPP	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus

Similar known gene clusters

Lanthipeptide predictions

Lanthipeptide(s) for slvB

slvN

Leader:

MATKDFNLDLVEVSKSNTGASTR

Core:

ITSHSFCSQACKTYKILGCNLLTHGCRFPR

Core with dehydrations:

IDhbDhaHDhaFCysDhaQACysKDhbYKILGCysNLLDhbHGCysRFPR

slvD

Leader:

MSTKDFNLDLVEVSKSNTGASAR

Core:

FTSHSLCTPGCITGVLMGCHIQSIGCNVHIHISK

Core with dehydrations:

FDhbDhaHDhaLCysDhbPGCysIDhbGVLMGCysHIQDhaIGCysNVHIHIDhaK

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

slvN - Class I

Cleavage pHMM score: 21.20

RODEO score: 23

Monoisotopic mass: 3275.7 Da

Molecular weight: 3277.8 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3295.9 Da N = 1; 3313.9 Da N = 2

slvD - Class I

Cleavage pHMM score: 19.50

RODEO score: 27

Monoisotopic mass: 3466.7 Da

Molecular weight: 3469.1 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3487.1 Da N = 1; 3505.1 Da N = 2; 3523.1 Da N = 3