BGC0000566: streptolysin S biosynthetic gene cluster from Streptococcus pyogenes M1 GAS
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
View antiSMASH-generated output
Download Cluster GenBank file
Download region SVG
Location: 598,677 - 606,966 nt. (total: 8,290 nt).
This entry is originally from NCBI GenBank AE004092.2.

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
other genes
resistance
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
General
Compounds
Genes
RiPP
History
KnownClusterBlast
General information about the BGC
MIBiG accession BGC0000566
Short description streptolysin S biosynthetic gene cluster from Streptococcus pyogenes M1 GAS
Status Minimal annotation: no
A minimal annotation only contains information on the BGC loci and one or more linked chemical product(s)

Completeness: complete
Whether the loci encodes everything needed for the pathway producing the compound(s)
Biosynthetic class(es)
  • RiPP (LAP)
Loci NCBI GenBank: AE004092.2
Compounds
  • streptolysin S
Species Streptococcus pyogenes M1 GAS [taxonomy]
References
Chemical products information
streptolysin S
(no structure information available)
List of genes involved in compound(s) production
Identifiers Position Product Functions Evidence Extra
  • SPy_0738
  • AAK33684.1
  • sagA
 598677 - 598838 (+) RiPP precursor peptide
  • Precursor biosynthesis
Activity assay
Heterologous expression
Knock-out
copy AA seq
copy Nt seq
  • SPy_0739
  • AAK33685.1
  • sagB
 599060 - 600010 (+) Dehydrogenase
  • Tailoring (Oxidation)
Activity assay
Heterologous expression
Sequence-based prediction
copy AA seq
copy Nt seq
  • SPy_0740
  • AAK33686.1
  • sagC
 600007 - 601065 (+) Cyclodehydratase partner
  • Tailoring (Heterocyclization)
Activity assay
Heterologous expression
Sequence-based prediction
copy AA seq
copy Nt seq
  • SPy_0741
  • AAK33687.1
 601085 - 602443 (+) Cyclodehydratase
  • Tailoring (Heterocyclization)
Activity assay
Heterologous expression
Sequence-based prediction
copy AA seq
copy Nt seq
  • SPy_0742
  • AAK33688.1
 602418 - 603089 (+) Putative protease
  • Activation / processing
Sequence-based prediction
copy AA seq
copy Nt seq
  • SPy_0743
  • AAK33689.1
 603086 - 603769 (+) hypothetical protein
copy AA seq
copy Nt seq
  • SPy_0744
  • AAK33690.1
 603792 - 604715 (+) ABC transporter
  • Transport
Sequence-based prediction
copy AA seq
copy Nt seq
  • SPy_0745
  • AAK33691.1
  • sagH
 604724 - 605851 (+) ABC transporter
  • Transport
Sequence-based prediction
copy AA seq
copy Nt seq
  • SPy_0746
  • AAK33692.1
 605848 - 606966 (+) ABC transporter
  • Transport
Sequence-based prediction
copy AA seq
copy Nt seq
RiPP-specific information
Subclass LAP
Cyclic? no
Peptidases
    SPy_0742
Precursor genes
sagA
Leader sequence: MLKFTSNILATSVAETTQVAPGG
Recognition motif: FxxxI
Core sequences:
  • CCCCCTTCCFSIATGSGNSQGGSGSYTPGK
Annotation changelog
MIBiG version Submitter Notes
1.0
  • Hidden contributor (ID: FTVL3IN3CWSJUJDTYVJJVU23, no GDPR consent given).
  • Submitted
2.0
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Migrated from v1.4
3.0
  • Hidden contributor (ID: 3UOU7PODQJXIM6BEPUHHRRA5, no GDPR consent given).
  • Remove negative molecular mass
3.1
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Update chemical activity to schema version 2.11
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.