BGC0000503: cinnamycin biosynthetic gene cluster from Streptomyces cinnamoneus
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
View antiSMASH-generated output
Download Cluster GenBank file
Download region SVG
Location: 1 - 17,083 nt. (total: 17,083 nt).
This entry is originally from NCBI GenBank AJ536588.1.

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
other genes
resistance
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
General
Compounds
Genes
RiPP
History
KnownClusterBlast
General information about the BGC
MIBiG accession BGC0000503
Short description cinnamycin biosynthetic gene cluster from Streptomyces cinnamoneus
Status Minimal annotation: no
A minimal annotation only contains information on the BGC loci and one or more linked chemical product(s)

Completeness: complete
Whether the loci encodes everything needed for the pathway producing the compound(s)
Biosynthetic class(es)
  • RiPP (Lanthipeptide)
Loci NCBI GenBank: AJ536588.1
Compounds
  • cinnamycin
Species Streptomyces cinnamoneus [taxonomy]
References
Chemical products information
cinnamycin
Copy SMILES
C89H125N25O25S3
Chemical database entries
PubCHEM
List of genes involved in compound(s) production
Identifiers Position Product Functions Evidence Extra
  • CAD60516.1
  • cinorf3
 1 - 346 (-) Cinorf3 protein
copy AA seq
copy Nt seq
  • CAD60517.1
  • cinorf4
 454 - 1026 (+) Cinorf4 protein
copy AA seq
copy Nt seq
  • CAD60518.1
 1109 - 1198 (+) hypothetical protein
copy AA seq
copy Nt seq
  • CAD60519.1
  • cinorf7
 1267 - 1626 (+) Cin orf7 protein
  • Scaffold biosynthesis
Other in vivo study
copy AA seq
copy Nt seq
  • CAD60520.1
  • cinA
 1671 - 1907 (+) preprocinnamycin
  • Precursor biosynthesis
Other in vivo study
copy AA seq
copy Nt seq
  • CAD60521.1
  • cinM
 2059 - 5325 (+) CinM protein
  • Scaffold biosynthesis
Activity assay
copy AA seq
copy Nt seq
  • CAD60522.1
  • cinX
 5340 - 6317 (+) CinX protein
  • Tailoring (Oxidation)
Activity assay
copy AA seq
copy Nt seq
  • CAD60523.1
  • cinT
 6543 - 7472 (+) CinT protein
  • Transport
Sequence-based prediction
copy AA seq
copy Nt seq
  • CAD60524.1
  • cinH
 7469 - 8341 (+) CinH protein
  • Transport
Sequence-based prediction
copy AA seq
copy Nt seq
  • CAD60525.1
  • cinY
 8444 - 9466 (+) CinY protein
copy AA seq
copy Nt seq
  • CAD60526.1
  • cinZ
 9545 - 10171 (-) CinZ protein
copy AA seq
copy Nt seq
  • CAD60527.1
  • cinorf8
 10246 - 10665 (+) Cinorf8 protein
copy AA seq
copy Nt seq
  • CAD60528.1
  • cinorf9
 10758 - 11078 (+) Cinorf9 protein
copy AA seq
copy Nt seq
  • CAD60529.1
  • cinR
 11111 - 11761 (-) CinR protein
  • Regulation
Sequence-based prediction
copy AA seq
copy Nt seq
  • CAD60530.1
  • cinK
 11758 - 12822 (-) CinK protein
  • Regulation
Sequence-based prediction
copy AA seq
copy Nt seq
  • CAD60531.1
  • cinorf10
 13257 - 13754 (+) Cinorf10 protein
copy AA seq
copy Nt seq
  • CAD60532.1
  • cinorf11
 13754 - 14944 (+) Cinorf11 protein
copy AA seq
copy Nt seq
  • CAD60533.1
  • cinR1
 14375 - 15160 (-) CinR1 protein
  • Regulation
Sequence-based prediction
copy AA seq
copy Nt seq
  • CAD60534.1
  • cinorf12
 15381 - 15872 (+) Cinorf12 protein
copy AA seq
copy Nt seq
  • CAD60535.1
  • cinorf13
 15912 - 16496 (+) Cinorf13 protein
copy AA seq
copy Nt seq
  • CAD60536.1
  • cinorf14
 16549 - >17083 (+) Cinorf14 protein
copy AA seq
copy Nt seq
RiPP-specific information
Subclass Lanthipeptide
Cyclic? yes
Precursor genes
cinA
Leader sequence: MTASILQQSVVDADFRAALLENPAAFGASAAALPTPVEAQDQASLDFWTKDIAATEAFA
Core sequences:
  • CRQSCSFGPFTFVCDGNTK
Crosslinks:
  • 1x18 (Thioether)
  • 4x14 (Thioether)
  • 5x11 (Thioether)
  • 6x19 (Unknown)
Annotation changelog
MIBiG version Submitter Notes
1.0
  • Hidden contributor (ID: Q466Z24KJDYPHZY2353Y4FFQ, no GDPR consent given).
  • Submitted
2.0
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Migrated from v1.4
  • Updated compound(s) information (NPAtlas curation)
3.0
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Updated bioactivity data
3.1
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Update chemical activity to schema version 2.11
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.