Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000385.1:
Cluster 1NRP1150063

BGC0000385, lysobactin biosynthetic gene cluster from Lysobacter sp. ATCC. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: lysobactin
PubChem ID: 197270
SMILES string: Copy to clipboard
Molecular formula: C58H97N15O17
Average molecular mass: 1276.502 Da

Class-specific details

Biosynthetic class(es):
NRP

Gene cluster description

lysobactin (BGC0000385). Gene Cluster 1. Biosynthetic class = NRP. GenBank JF412274. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

AEH59024.1 leader / core peptide, putative Class II
MALRGGIGRLAFAHGSGVAAIRDGGFAFA - AVAWCGMDDhaLWRGLVVGGDhbDhaVPDhbLLAQFAAIRPKRVGDhbEVPPDhbQA
AEH59091.1 leader / core peptide, putative Class II
MADPAPRPKHCAGERLRRAARNRTETYIHDAAHSSSAPRCAHGNLDTLRAG - MLQALRIVGCMVRPRQ
AEH59092.1 leader / core peptide, putative Class II
MHRIKLIALGVLLAA - DhaADhaDhbGAADhbQAQGCFCDhaDhbIYYNDAGDDhbVGVRQPADhaCGDDhbGYGDhbVDhbKKYKVVAGCVI
AEH59108.1 leader / core peptide, putative Class II
MPSIASRRAAQPTAAMWQEDAMRERRADTVACG - PVPDEKQPFVPERACDhbLAE

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

Literature references

1. Hou J et al. (2011) Identification and characterization of the lysobactin biosynthetic gene cluster reveals mechanistic insights into an unusual termination module architecture. Chem Biol 18(5):655-64. doi: 10.1016/j.chembiol.2011.02.012.