ClusterBlast scores for BGC0000450

Table of genes, locations, strands and annotations of query cluster:
trsD	0	984	+	putative ABC transporter	
trsE	980	1805	+	putative ABC transporter	
trsF	1911	3117	+	putative esterase	
trsG	3235	3739	-	putative DNA-binding response regulator	
trsH	3882	4095	-	MbtH-like protein	
trsI	4141	13600	-	putative non-ribosomal peptide synthetase	
MIPLSYAQRRMWFINRFEGPSSTYNIPLLLRFHGSLDTAALRAAFQDVLV	13607	21665	-	trsJ	
trsK	21675	22374	+	putative SAM-dependent methyltransferase	
trsL	22437	23823	+	hypothetical protein	
trsM	24007	26386	+	UvrA-like protein	
trsN	26467	27406	+	putative oxidoreductase	
trsO	27802	29182	-	putative FAD-dependent oxidoreductase	
trsP	29168	30257	-	putative dehydrogenase	
trsQ	30253	31000	-	putative thioesterase	
trsB	31153	32359	+	putative cytochrome P450	
trsA	32372	33956	+	AMP-binding ligase	
trsC	34034	34778	-	putative tryptophan 2,3-dioxygenase	
trsR	34967	36746	+	putative non-ribosomal peptide synthetase	


Significant hits: 
1. BGC0000450.5	triostin A
2. BGC0000415.5	quinomycin
3. BGC0000339.5	echinomycin
4. BGC0000434.5	SW-163C/UK-63598/SW-163E/SW-163F/SW-163G
5. BGC0000445.5	thiocoraline
6. BGC0001228.5	retimycin A
7. BGC0001036.5	polyoxypeptin
8. BGC0001582.4	ecumicin
9. BGC0002293.2	ohmyungsamycin A/ohmyungsamycin B
10. BGC0002109.3	kitacinnamycin A/kitacinnamycin B/kitacinnamycin C/kitacinnamycin D/kitacinnamycin E/kitacinnamycin F
11. BGC0001297.4	WS9326A/WS9326C/WS9326D
12. BGC0002676.2	skyllamycin D/skyllamycin E
13. BGC0000374.5	hormaomycin/hormaomycin A1/hormaomycin A2/hormaomycin A3/hormaomycin A4/hormaomycin A5/hormaomycin A6
14. BGC0001975.4	atratumycin
15. BGC0000429.4	skyllamycin A/skyllamycin B
16. BGC0002108.3	cinnapeptin
17. BGC0000296.5	actinomycin D
18. BGC0002014.3	pepticinnamin E
19. BGC0001039.5	pyridomycin
20. BGC0000336.5	daptomycin
21. BGC0000439.5	taromycin A
22. BGC0002735.2	incarnatapeptin A/incarnatapeptin B/dentigerumycin F/dentigerumycin G
23. BGC0002360.3	depsibosamycin B/depsibosamycin C/depsibosamycin D
24. BGC0000378.5	Kutzneride 1/Kutzneride 2/Kutzneride 3/Kutzneride 4/Kutzneride 5/Kutzneride 6/Kutzneride 7/Kutzneride 8
25. BGC0001414.5	griselimycin
26. BGC0002089.2	thaxtomin D/thaxtomin A/thaxtomin C/thaxtomin B
27. BGC0000306.5	arylomycin
28. BGC0002581.2	bosamycin A/bosamycin B/bosamycin C/bosamycin D/bosamycin E/bosamycin F
29. BGC0001967.4	acyldepsipeptide 1
30. BGC0000388.5	mannopeptimycin
31. BGC0001807.4	totopotensamide A/totopotensamide B
32. BGC0001214.5	marformycin A/marformycin B/marformycin C/marformycin D/marformycin E/marformycin F
33. BGC0000315.5	CDA1b/CDA2a/CDA2b/CDA3a/CDA3b/CDA4a/CDA4b
34. BGC0002702.3	GP6738
35. BGC0000341.5	enduracidin A/enduracidin B
36. BGC0000461.5	WAP-8294A2
37. BGC0001230.5	salinamide A/salinamide B/salinamide C/salinamide D/salinamide E/salinamide F/desmethylsalinamide C/desmethylsalinamide E
38. BGC0002384.3	lysocin E
39. BGC0002637.3	rimomycin A/rimomycin B/rimomycin C
40. BGC0002100.2	colibrimycin
41. BGC0001968.3	cadaside A/cadaside B
42. BGC0000081.5	kedarcidin
43. BGC0000233.5	hedamycin
44. BGC0001074.5	cosmomycin D
45. BGC0001568.5	cytorhodin
46. BGC0001558.5	cosmomycin C
47. BGC0001061.4	polyketomycin
48. BGC0001351.3	cahuitamycin A/cahuitamycin B/cahuitamycin C
49. BGC0002686.2	madurastatin D1/madurastatin D2/(-)-Madurastatin C1
50. BGC0002718.2	madurastatin A2/madurastatin E1/madurastatin F/madurastatin G1/madurastatin A1


Details:

>>
1. BGC0000450.5
Source: triostin A
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 18
Cumulative BLAST score: 23138.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	BAH04156.1	100	629	100.0	1.5e-230
trsE	BAH04157.1	100	520	100.0	2.38e-189
trsF	BAH04158.1	100	790	100.0	9.27e-292
trsG	BAH04159.1	100	343	100.0	4.4e-123
trsH	BAH04160.1	100	150	100.0	9.19e-50
trsI	BAH04161.1	100	6300	100.0	0.0
MIPLSYAQRRMWFINRFEGPSSTYNIPLLLRFHGSLDTAALRAAFQDVLV	BAH04162.1	100	5239	100.0	0.0
trsK	BAH04163.1	100	466	100.0	1.45e-169
trsL	BAH04164.1	100	924	100.0	0.0
trsM	BAH04165.1	100	1550	100.0	0.0
trsN	BAH04166.1	100	613	100.0	8.29e-225
trsO	BAH04167.1	100	930	100.0	0.0
trsP	BAH04168.1	100	706	100.0	3.7e-260
trsQ	BAH04169.1	100	509	100.0	5.93e-186
trsB	BAH04170.1	100	775	100.0	8.15e-286
trsA	BAH04171.1	100	1058	100.0	0.0
trsC	BAH04172.1	100	499	100.0	3.56e-182
trsR	BAH04173.1	100	1137	100.0	0.0



>>
2. BGC0000415.5
Source: quinomycin
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 16
Cumulative BLAST score: 20391.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsE	AET98901.1	95	496	100.0	9.54e-180
trsF	AET98902.1	93	739	100.0	8.55e-272
trsG	AET98903.1	98	337	100.0	1.66e-120
trsH	AET98904.1	97	147	100.0	2.17e-48
trsI	AET98905.1	93	5915	100.0	0.0
MIPLSYAQRRMWFINRFEGPSSTYNIPLLLRFHGSLDTAALRAAFQDVLV	AET98906.1	94	4866	99.32960893854748	0.0
trsK	AET98907.1	94	441	100.0	2.38e-159
trsM	AET98908.1	98	1521	100.0	0.0
trsN	AET98909.1	94	566	100.0	3.26e-206
trsO	AET98910.1	93	869	99.56427015250546	0.0
trsP	AET98911.1	94	669	100.0	3.19e-245
trsQ	AET98912.1	97	499	100.0	7.76e-182
trsB	AET98913.1	97	748	100.0	1.88e-275
trsA	AET98914.1	95	1011	100.0	0.0
trsC	AET98915.1	94	469	100.0	7.41e-170
trsR	AET98916.1	97	1098	100.0	0.0



>>
3. BGC0000339.5
Source: echinomycin
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 14
Cumulative BLAST score: 15377.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsF	BAE98163.1	66	495	95.76059850374065	2.74e-175
trsG	BAE98158.1	88	296	97.60479041916167	1.77e-104
trsH	BAE98157.1	84	124	95.71428571428572	3.13e-39
trsI	BAE98156.1	79	5051	100.1269035532995	0.0
MIPLSYAQRRMWFINRFEGPSSTYNIPLLLRFHGSLDTAALRAAFQDVLV	BAE98155.1	74	3707	97.35567970204842	0.0
trsK	BAE98167.1	68	316	96.55172413793103	4.06e-110
trsM	BAE98165.1	88	1374	99.87373737373737	0.0
trsN	BAE98166.1	69	432	99.67948717948718	3.3e-153
trsO	BAE98154.1	72	647	98.69281045751634	4.01e-233
trsP	BAE98153.1	81	555	95.30386740331491	1.92e-200
trsQ	BAE98152.1	72	367	99.59677419354838	7.07e-130
trsB	BAE98161.1	68	514	97.50623441396509	3.8e-183
trsA	BAE98151.1	82	862	99.05123339658444	2.63e-316
trsR	BAE98162.1	59	637	100.67567567567568	4.71e-225



>>
4. BGC0000434.5
Source: SW-163C/UK-63598/SW-163E/SW-163F/SW-163G
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 14
Cumulative BLAST score: 14765.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	BAI63276.1	78	485	99.69418960244649	1.06e-173
trsE	BAI63277.1	73	383	98.90510948905109	3.01e-135
trsG	BAI63291.1	72	234	98.80239520958084	1.34e-79
trsH	BAI63290.1	85	132	97.14285714285714	2.78e-42
trsI	BAI63289.1	74	4690	100.34898477157361	0.0
MIPLSYAQRRMWFINRFEGPSSTYNIPLLLRFHGSLDTAALRAAFQDVLV	BAI63288.1	75	3694	96.31284916201118	0.0
trsK	BAI63280.1	56	239	95.6896551724138	5.72e-80
trsL	BAI63293.1	66	548	88.72017353579176	2.88e-194
trsM	BAI63287.1	80	1262	99.87373737373737	0.0
trsN	BAI63292.1	75	471	99.67948717948718	9.6e-169
trsQ	BAI63286.1	72	375	97.98387096774194	6.37e-133
trsB	BAI63285.1	78	617	99.50124688279301	8.54e-223
trsA	BAI63284.1	73	789	100.18975332068311	2.27e-287
trsR	BAI63283.1	77	846	97.46621621621621	9.01e-308



>>
5. BGC0000445.5
Source: thiocoraline
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 11
Cumulative BLAST score: 11861.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	CAJ34360.1	72	459	99.08256880733946	2.26e-163
trsE	CAJ34359.1	69	364	100.0	1.13e-127
trsG	CAJ34378.1	73	253	100.0	3e-87
trsG	CAJ34357.1	60	198	96.40718562874252	5.79e-65
trsH	CAJ34376.1	84	132	97.14285714285714	1.41e-42
trsI	CAJ34375.1	65	4144	100.253807106599	0.0
MIPLSYAQRRMWFINRFEGPSSTYNIPLLLRFHGSLDTAALRAAFQDVLV	CAJ34374.1	62	3006	97.16945996275605	0.0
trsM	CAJ34377.1	73	1129	98.23232323232324	0.0
trsQ	CAJ34373.1	69	357	96.7741935483871	5.77e-126
trsB	CAJ34365.1	67	492	98.50374064837905	3.4e-174
trsA	CAJ34366.1	63	671	98.67172675521822	6.4e-241
trsR	CAJ34367.1	60	656	99.66216216216216	8.14e-233



>>
6. BGC0001228.5
Source: retimycin A
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 10
Cumulative BLAST score: 11090.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	B110_RS0125675	73	448	97.85932721712538	3.97e-159
trsE	B110_RS0125680	70	359	97.8102189781022	7.31e-126
trsG	B110_RS27190	70	187	78.44311377245509	7.75e-62
trsH	B110_RS0125710	74	117	97.14285714285714	2.49e-36
trsI	B110_RS0125715	70	4407	100.1269035532995	0.0
MIPLSYAQRRMWFINRFEGPSSTYNIPLLLRFHGSLDTAALRAAFQDVLV	B110_RS0125720	64	3115	96.42458100558659	0.0
trsL	B110_RS27180	58	504	95.87852494577007	6.12e-177
trsM	B110_RS0125725	78	1211	97.85353535353535	0.0
trsN	B110_RS0125690	66	401	98.07692307692307	6.62e-141
trsQ	B110_RS27195	66	341	97.98387096774194	1.37e-119



>>
7. BGC0001036.5
Source: polyoxypeptin
Type: NRPS:Type I+PKS
Number of proteins with BLAST hits to this cluster: 4
Cumulative BLAST score: 3544.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	AGZ15462.1	48	263	96.3302752293578	2.11e-86
trsH	AGZ15453.1	69	99	97.14285714285714	5.38e-29
trsI	AGZ15460.1	46	1319	53.52157360406091	0.0
MIPLSYAQRRMWFINRFEGPSSTYNIPLLLRFHGSLDTAALRAAFQDVLV	AGZ15459.1	46	1863	98.65921787709497	0.0



>>
8. BGC0001582.4
Source: ecumicin
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 4
Cumulative BLAST score: 3011.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	AIW58900.1	54	282	86.85015290519877	2.99e-94
trsH	AIW58893.1	55	85	92.85714285714286	1.71e-23
trsI	AIW58892.1	47	2315	94.51142131979695	0.0
trsR	AIW58892.1	46	329	76.18243243243244	4.39e-98



>>
9. BGC0002293.2
Source: ohmyungsamycin A/ohmyungsamycin B
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 3
Cumulative BLAST score: 2736.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	QGA70155.1	57	323	96.3302752293578	6.99e-110
trsH	QGA70149.1	60	88	92.85714285714286	1.06e-24
trsI	QGA70148.1	47	2325	94.2258883248731	0.0



>>
10. BGC0002109.3
Source: kitacinnamycin A/kitacinnamycin B/kitacinnamycin C/kitacinnamycin D/kitacinnamycin E/kitacinnamycin F
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 4
Cumulative BLAST score: 2463.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	QDJ74277.1	57	327	95.71865443425077	3.03e-111
trsH	QDJ74286.1	62	100	98.57142857142858	1.29e-29
trsI	QDJ74273.1	48	1267	50.983502538071065	0.0
trsR	QDJ74275.1	46	410	98.98648648648648	2.62e-126
trsR	QDJ74273.1	49	359	77.7027027027027	1.82e-108



>>
11. BGC0001297.4
Source: WS9326A/WS9326C/WS9326D
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 4
Cumulative BLAST score: 1949.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	ALG65297.1	50	281	93.57798165137615	1.02e-93
trsH	ALG65332.1	63	90	91.42857142857143	1.78e-25
trsI	ALG65319.1	46	1245	51.935279187817265	0.0
trsR	ALG65319.1	46	333	75.50675675675676	1.27e-99



>>
12. BGC0002676.2
Source: skyllamycin D/skyllamycin E
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 5
Cumulative BLAST score: 1735.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	KZO11_19495	53	306	96.3302752293578	2.68e-103
trsH	KZO11_19595	61	94	91.42857142857143	5.46e-27
trsB	KZO11_19510	53	418	99.25187032418953	1.25e-144
trsA	KZO11_19365	48	451	101.5180265654649	8.26e-154
trsR	KZO11_19520	48	466	98.1418918918919	1.6e-145



>>
13. BGC0000374.5
Source: hormaomycin/hormaomycin A1/hormaomycin A2/hormaomycin A3/hormaomycin A4/hormaomycin A5/hormaomycin A6
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 3
Cumulative BLAST score: 1488.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	AEH41800.1	59	89	92.85714285714286	3.59e-25
trsI	AEH41794.1	46	961	40.513959390862944	1.78e-291
trsR	AEH41794.1	47	438	99.32432432432432	8.5e-136



>>
14. BGC0001975.4
Source: atratumycin
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 4
Cumulative BLAST score: 1301.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	QBG38790.1	55	323	96.3302752293578	6.54e-110
trsH	QBG38778.1	60	99	97.14285714285714	2.6e-29
trsB	QBG38788.1	51	400	98.25436408977556	1.16e-137
trsR	QBG38783.1	50	479	99.66216216216216	3.28e-150



>>
15. BGC0000429.4
Source: skyllamycin A/skyllamycin B
Type: NRPS:Type I+PKS
Number of proteins with BLAST hits to this cluster: 4
Cumulative BLAST score: 1277.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	AEA30278.1	53	306	96.3302752293578	2.68e-103
trsH	AEA30258.1	61	94	91.42857142857143	5.46e-27
trsB	AEA30275.1	54	419	99.25187032418953	3.1e-145
trsR	AEA30273.1	48	458	98.1418918918919	7.5e-143



>>
16. BGC0002108.3
Source: cinnapeptin
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 4
Cumulative BLAST score: 1252.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	QNH67555.1	56	325	95.41284403669725	8.06e-111
trsH	QNH67549.1	63	102	97.14285714285714	1.56e-30
trsB	QNH67553.1	51	398	98.00498753117208	6.38e-137
trsR	QNH67550.1	46	427	100.0	6.82e-132



>>
17. BGC0000296.5
Source: actinomycin D
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 3
Cumulative BLAST score: 3574.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	ADG27347.1	46	235	96.63608562691131	2.35e-75
trsI	ADG27359.1	46	2593	103.36294416243655	0.0
trsM	ADG27345.1	51	746	97.72727272727273	1.5e-262



>>
18. BGC0002014.3
Source: pepticinnamin E
Type: NRPS:Type I+PKS
Number of proteins with BLAST hits to this cluster: 3
Cumulative BLAST score: 1179.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	OK006_RS36485	54	307	95.71865443425077	1.47e-103
trsH	OK006_RS36470	58	86	91.42857142857143	7.42e-24
trsR	OK006_RS36465	48	438	98.98648648648648	5.7e-136
trsR	OK006_RS36605	48	348	72.63513513513513	6.71e-105



>>
19. BGC0001039.5
Source: pyridomycin
Type: NRPS:Type I+PKS
Number of proteins with BLAST hits to this cluster: 3
Cumulative BLAST score: 1067.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	AEF33081.1	51	74	87.14285714285714	3.07e-19
trsA	AEF33098.1	52	528	100.94876660341556	4.91e-184
trsR	AEF33078.1	47	465	99.49324324324324	9.56e-146



>>
20. BGC0000336.5
Source: daptomycin
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 3
Cumulative BLAST score: 833.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	AAX31553.1	53	289	93.27217125382263	1.41e-96
trsH	AAX31560.1	59	90	87.14285714285714	1.93e-25
trsR	AAX31559.1	49	454	97.97297297297297	1.19e-141



>>
21. BGC0000439.5
Source: taromycin A
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 3
Cumulative BLAST score: 800.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	AHH53501.1	51	270	89.29663608562691	1.66e-89
trsH	AHH53509.1	68	100	92.85714285714286	1.88e-29
trsR	AHH53508.1	47	430	98.47972972972973	4.69e-133



>>
22. BGC0002735.2
Source: incarnatapeptin A/incarnatapeptin B/dentigerumycin F/dentigerumycin G
Type: PKS+NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 2193.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	ABB07_39150	49	271	99.08256880733946	1.01e-89
MIPLSYAQRRMWFINRFEGPSSTYNIPLLLRFHGSLDTAALRAAFQDVLV	ABB07_39125	46	1922	98.95716945996276	0.0



>>
23. BGC0002360.3
Source: depsibosamycin B/depsibosamycin C/depsibosamycin D
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 1389.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	UEF20581.1	55	83	92.85714285714286	9.12e-23
trsR	UEF20592.1	46	449	99.49324324324324	4.74e-145
trsR	UEF20578.1	46	435	99.49324324324324	7.2e-135
trsR	UEF20580.1	46	422	99.49324324324324	2.55e-130



>>
24. BGC0000378.5
Source: Kutzneride 1/Kutzneride 2/Kutzneride 3/Kutzneride 4/Kutzneride 5/Kutzneride 6/Kutzneride 7/Kutzneride 8
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 1384.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	ABV56590.1	77	115	97.14285714285714	1.48e-35
MIPLSYAQRRMWFINRFEGPSSTYNIPLLLRFHGSLDTAALRAAFQDVLV	ABV56585.1	48	1269	57.61638733705773	0.0



>>
25. BGC0001414.5
Source: griselimycin
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 880.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	AKC91858.1	55	84	92.85714285714286	4.89e-23
trsR	AKC91849.1	46	444	100.0	6.81e-138
trsR	AKC91856.1	48	352	72.97297297297297	4.33e-106



>>
26. BGC0002089.2
Source: thaxtomin D/thaxtomin A/thaxtomin C/thaxtomin B
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 809.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	SCAB_31771	58	89	88.57142857142857	2.1e-25
trsR	SCAB_31781	51	380	75.16891891891892	5.83e-117
trsR	SCAB_31791	48	340	73.98648648648648	9.96e-103



>>
27. BGC0000306.5
Source: arylomycin
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 568.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	SSIG_05824	61	97	98.57142857142858	3.29e-28
trsR	SSIG_05823	48	471	99.83108108108108	3.95e-147



>>
28. BGC0002581.2
Source: bosamycin A/bosamycin B/bosamycin C/bosamycin D/bosamycin E/bosamycin F
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 526.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	QKF54439.1	55	83	92.85714285714286	9.12e-23
trsR	QKF54435.2	46	443	99.49324324324324	1.46e-137



>>
29. BGC0001967.4
Source: acyldepsipeptide 1
Type: NRPS:Type I+PKS
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 526.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	QED88056.1	54	82	92.85714285714286	1.64e-22
trsR	QED88054.1	48	444	98.81756756756756	8.84e-138



>>
30. BGC0000388.5
Source: mannopeptimycin
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 521.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	AAU34213.1	59	94	97.14285714285714	5.17e-27
trsR	AAU34203.1	47	427	95.6081081081081	4.66e-132



>>
31. BGC0001807.4
Source: totopotensamide A/totopotensamide B
Type: NRPS:Type I+PKS
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 506.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	ATL73054.1	63	96	97.14285714285714	8.94e-28
trsR	ATL73036.1	46	410	95.94594594594594	3.64e-126



>>
32. BGC0001214.5
Source: marformycin A/marformycin B/marformycin C/marformycin D/marformycin E/marformycin F
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 504.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	AJV88378.1	64	96	95.71428571428572	7.01e-28
trsR	AJV88377.1	46	408	98.3108108108108	2.15e-125



>>
33. BGC0000315.5
Source: CDA1b/CDA2a/CDA2b/CDA3a/CDA3b/CDA4a/CDA4b
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 503.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	CAB38589.1	63	94	92.85714285714286	2.56e-27
trsR	CAB38518.1	46	409	95.4391891891892	9.28e-126



>>
34. BGC0002702.3
Source: GP6738
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 502.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	DMB38_33835	67	102	95.71428571428572	1.3e-30
trsR	DMB38_33860	46	400	99.49324324324324	1.03e-122



>>
35. BGC0000341.5
Source: enduracidin A/enduracidin B
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 494.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	ABD65966.1	62	94	92.85714285714286	2.56e-27
trsR	ABD65957.1	46	400	98.81756756756756	7.88e-123



>>
36. BGC0000461.5
Source: WAP-8294A2
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 455.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	AEP18654.1	71	100	87.14285714285714	1.36e-29
trsR	AEP18656.1	49	355	75.50675675675676	5.47e-107



>>
37. BGC0001230.5
Source: salinamide A/salinamide B/salinamide C/salinamide D/salinamide E/salinamide F/desmethylsalinamide C/desmethylsalinamide E
Type: NRPS:Type I+PKS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 448.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	DAB41475.1	59	87	92.85714285714286	2.08e-24
trsR	DAB41477.1	48	361	77.19594594594594	2.79e-109



>>
38. BGC0002384.3
Source: lysocin E
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 440.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	QWM97321.1	68	101	92.85714285714286	5.28e-30
trsR	QWM97319.1	49	339	75.0	1.12e-101



>>
39. BGC0002637.3
Source: rimomycin A/rimomycin B/rimomycin C
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 421.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	DMH18_08075	69	99	87.14285714285714	4.11e-29
trsR	DMH18_08085	46	322	78.04054054054053	9.93e-96



>>
40. BGC0002100.2
Source: colibrimycin
Type: NRPS:Type I+other:other
Number of proteins with BLAST hits to this cluster: 3
Cumulative BLAST score: 843.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	DBP21_21555	57	313	94.4954128440367	3.07e-106
trsH	DBP21_21550	64	96	91.42857142857143	6.46e-28
trsB	DBP21_21665	54	434	97.2568578553616	5.82e-151



>>
41. BGC0001968.3
Source: cadaside A/cadaside B
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 3
Cumulative BLAST score: 795.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	QBC75016.1	52	290	93.57798165137615	3.96e-97
trsH	QBC75024.1	57	84	92.85714285714286	2.49e-23
trsB	QBC75013.1	55	421	98.25436408977556	4.61e-146



>>
42. BGC0000081.5
Source: kedarcidin
Type: NRPS:Type I+PKS:Iterative type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 1212.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsM	AFV52154.1	54	795	98.23232323232324	1.23e-281
trsA	AFV52187.1	46	417	101.707779886148	2e-140



>>
43. BGC0000233.5
Source: hedamycin
Type: PKS
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 1002.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	AAP85350.1	54	305	94.18960244648318	7.21e-103
trsM	AAP85339.1	49	697	98.35858585858585	3.81e-243



>>
44. BGC0001074.5
Source: cosmomycin D
Type: saccharide+PKS
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 978.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	DF19_23560	54	302	95.41284403669725	1.41e-101
trsM	DF19_23575	47	676	97.72727272727273	5.59e-235



>>
45. BGC0001568.5
Source: cytorhodin
Type: PKS
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 968.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	ATJ00748.1	54	299	94.4954128440367	2.21e-100
trsM	ATJ00745.1	47	669	97.72727272727273	4.11e-232



>>
46. BGC0001558.5
Source: cosmomycin C
Type: PKS
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 967.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	D329_RS0122430	54	299	94.4954128440367	2.21e-100
trsM	D329_RS0122445	47	668	97.72727272727273	8.24e-232



>>
47. BGC0001061.4
Source: polyketomycin
Type: PKS:Type II aromatic
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 721.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsD	ACN64822.1	55	303	94.80122324159022	1.87e-102
trsA	ACN64830.1	46	418	102.08728652751422	4.85e-141



>>
48. BGC0001351.3
Source: cahuitamycin A/cahuitamycin B/cahuitamycin C
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 633.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	AMK48229.1	66	96	95.71428571428572	4.55e-28
trsA	AMK48234.1	53	537	100.18975332068311	1.18e-187



>>
49. BGC0002686.2
Source: madurastatin D1/madurastatin D2/(-)-Madurastatin C1
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 629.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	FKD65_RS04315	61	91	87.14285714285714	7.93e-26
trsA	FKD65_RS04500	54	538	99.43074003795066	2.77e-188



>>
50. BGC0002718.2
Source: madurastatin A2/madurastatin E1/madurastatin F/madurastatin G1/madurastatin A1
Type: NRPS:Type I
Number of proteins with BLAST hits to this cluster: 2
Cumulative BLAST score: 628.0

Table of genes, locations, strands and annotations of subject cluster:

Table of Blast hits (query gene, subject gene, %identity, blast score, %coverage, e-value):
trsH	amrb99_16320	67	97	87.14285714285714	1.87e-28
trsA	amrb99_16370	54	531	100.0	1.23e-185

