BGC0000450: triostin A biosynthetic gene cluster from Streptomyces triostinicus
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
View antiSMASH-generated output
Download Cluster GenBank file
Download region SVG
Location: 1 - 36,746 nt. (total: 36,746 nt).
This entry is originally from NCBI GenBank AB366635.1.

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
other genes
resistance
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
General
Compounds
Genes
NRP
History
NRPS/PKS domains
KnownClusterBlast
General information about the BGC
MIBiG accession BGC0000450
Short description triostin A biosynthetic gene cluster from Streptomyces triostinicus
Status Minimal annotation: no
A minimal annotation only contains information on the BGC loci and one or more linked chemical product(s)

Completeness: Unknown
Whether the loci encodes everything needed for the pathway producing the compound(s)
Biosynthetic class(es)
  • NRP
Loci NCBI GenBank: AB366635.1
Compounds
  • triostin A
Species Streptomyces triostinicus [taxonomy]
References
Chemical products information
triostin A
Copy SMILES
C50H62N12O12S2
Chemical database entries
NPAtlas
PubCHEM
List of genes involved in compound(s) production
Identifiers Position Product Functions Evidence Extra
  • BAH04156.1
  • trsD
 1 - 984 (+) putative ABC transporter
copy AA seq
copy Nt seq
  • BAH04157.1
  • trsE
 981 - 1805 (+) putative ABC transporter
copy AA seq
copy Nt seq
  • BAH04158.1
  • trsF
 1912 - 3117 (+) putative esterase
copy AA seq
copy Nt seq
  • BAH04159.1
  • trsG
 3236 - 3739 (-) putative DNA-binding response regulator
copy AA seq
copy Nt seq
  • BAH04160.1
  • trsH
 3883 - 4095 (-) MbtH-like protein
copy AA seq
copy Nt seq
  • BAH04161.1
  • trsI
 4142 - 13600 (-) putative non-ribosomal peptide synthetase
copy AA seq
copy Nt seq
  • BAH04162.1
  • MIPLSYAQRRMWFINRFEGPSSTYNIPLLLRFHGSLDTAALRAAFQDVLV
 13608 - 21665 (-) trsJ
copy AA seq
copy Nt seq
  • BAH04163.1
  • trsK
 21676 - 22374 (+) putative SAM-dependent methyltransferase
copy AA seq
copy Nt seq
  • BAH04164.1
  • trsL
 22438 - 23823 (+) hypothetical protein
copy AA seq
copy Nt seq
  • BAH04165.1
  • trsM
 24008 - 26386 (+) UvrA-like protein
copy AA seq
copy Nt seq
  • BAH04166.1
  • trsN
 26468 - 27406 (+) putative oxidoreductase
copy AA seq
copy Nt seq
  • BAH04167.1
  • trsO
 27803 - 29182 (-) putative FAD-dependent oxidoreductase
copy AA seq
copy Nt seq
  • BAH04168.1
  • trsP
 29169 - 30257 (-) putative dehydrogenase
copy AA seq
copy Nt seq
  • BAH04169.1
  • trsQ
 30254 - 31000 (-) putative thioesterase
copy AA seq
copy Nt seq
  • BAH04170.1
  • trsB
 31154 - 32359 (+) putative cytochrome P450
copy AA seq
copy Nt seq
  • BAH04171.1
  • trsA
 32373 - 33956 (+) AMP-binding ligase
copy AA seq
copy Nt seq
  • BAH04172.1
  • trsC
 34035 - 34778 (-) putative tryptophan 2,3-dioxygenase
copy AA seq
copy Nt seq
  • BAH04173.1
  • trsR
 34968 - 36746 (+) putative non-ribosomal peptide synthetase
copy AA seq
copy Nt seq
NRP-specific information
Subclass N/A
Cyclic? no
NRP-synthases
Gene Modules
trsI
Module ?
Specificity: cysteine
Evidence for specificity:
  • Structure-based inference
Module ?
Specificity: valine
Evidence for specificity:
  • Structure-based inference
MIPLSYAQRRMWFINRFEGPSSTYNIPLLLRFHGSLDTAALRAAFQDVLV
Module ?
Specificity: serine
Evidence for specificity:
  • Structure-based inference
Module ?
Specificity: alanine
Evidence for specificity:
  • Structure-based inference
trsA
Module ?
Specificity: quinoxaline-2-carboxylic acid
Evidence for specificity:
  • Structure-based inference
trsR
Module ?
Specificity: tryptophan
Evidence for specificity:
  • Structure-based inference
Annotation changelog
MIBiG version Submitter Notes
1.0
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Submitted
2.0
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Migrated from v1.4
  • Updated reference publication(s) (MIBiG Annotathon)
  • Updated compound(s) information (NPAtlas curation)
3.0
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Updated bioactivity data
  • Added NRP substrate specificities
3.1
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Update chemical activity to schema version 2.11
Detailed domain annotation
Shows NRPS- and PKS-related domains for each feature that contains them. Click on each domain for more information about the domain's location, consensus monomer prediction, and other details.
A glossary is available here.
Selected features only
Show module domains
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.