BGC0000479: prenylagaramide B biosynthetic gene cluster from Planktothrix agardhii NIES-596
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
View antiSMASH-generated output
Download Cluster GenBank file
Download region SVG
Location: 1 - 13,422 nt. (total: 13,422 nt).
This entry is originally from NCBI GenBank HQ655154.1.

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
other genes
resistance
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
General
Compounds
Genes
RiPP
History
KnownClusterBlast
General information about the BGC
MIBiG accession BGC0000479
Short description prenylagaramide B biosynthetic gene cluster from Planktothrix agardhii NIES-596
Status Minimal annotation: no
A minimal annotation only contains information on the BGC loci and one or more linked chemical product(s)

Completeness: complete
Whether the loci encodes everything needed for the pathway producing the compound(s)
Biosynthetic class(es)
  • RiPP (Lanthipeptide)
Loci NCBI GenBank: HQ655154.1
Compounds
  • prenylagaramide B
  • prenylagaramide C
Species Planktothrix agardhii NIES-596 [taxonomy]
References
Chemical products information
prenylagaramide B
Copy SMILES
C49H68N8O10
Chemical database entries
NPAtlas
PubCHEM
prenylagaramide C
Copy SMILES
C52H80N10O11
List of genes involved in compound(s) production
Identifiers Position Product Functions Evidence Extra
  • AED99424.1
  • pagC
 1 - 198 (-) hypothetical protein
copy AA seq
copy Nt seq
  • AED99425.1
  • pagB
 246 - 455 (-) hypothetical protein
copy AA seq
copy Nt seq
  • AED99426.1
  • pagA
 522 - 2489 (-) N-terminal cyanobactin protease
copy AA seq
copy Nt seq
  • AED99427.1
 2608 - 2997 (-) conserved hypothetical protein
copy AA seq
copy Nt seq
  • AED99428.1
 3295 - 3873 (-) conserved hypothetical protein
copy AA seq
copy Nt seq
  • AED99429.1
  • pagF
 3873 - 4775 (-) putative prenyl transferase
copy AA seq
copy Nt seq
  • AED99430.1
 4806 - 5621 (+) transposase
copy AA seq
copy Nt seq
  • AED99431.1
  • pagE7
 5655 - 5807 (-) prenylagaramide C precursor peptide
copy AA seq
copy Nt seq
  • AED99432.1
  • pagE6
 6095 - 6241 (-) prenylagaramide B precursor peptide
copy AA seq
copy Nt seq
  • AED99433.1
  • pagE5
 6405 - 6551 (-) cyanobactin precursor peptide
copy AA seq
copy Nt seq
  • AED99434.1
  • pagE4
 6835 - 7032 (-) cyanobactin precursor peptide
copy AA seq
copy Nt seq
  • AED99435.1
 7209 - 7535 (+) conserved hypothetical protein
copy AA seq
copy Nt seq
  • AED99436.1
 7532 - 7789 (+) conserved hypothetical protein
copy AA seq
copy Nt seq
  • AED99437.1
 8087 - 8314 (+) conserved hypothetical protein
copy AA seq
copy Nt seq
  • AED99438.1
 8314 - 8589 (+) conserved hypothetical protein
copy AA seq
copy Nt seq
  • AED99439.1
  • pagE3
 8603 - 8689 (-) cyanobactin precursor peptide
copy AA seq
copy Nt seq
  • AED99440.1
 8831 - 9064 (-) conserved hypothetical protein
copy AA seq
copy Nt seq
  • AED99441.1
 9075 - 9362 (-) conserved hypothetical protein
copy AA seq
copy Nt seq
  • AED99442.1
 9369 - 9653 (+) transposase
copy AA seq
copy Nt seq
  • AED99443.1
  • pagE2
 9616 - 9852 (-) cyanobactin precursor peptide
copy AA seq
copy Nt seq
  • AED99444.1
 10031 - 10615 (+) conserved hypothetical protein
copy AA seq
copy Nt seq
  • AED99445.1
  • pagE1
 11007 - 11162 (-) cyanobactin precursor peptide
copy AA seq
copy Nt seq
  • AED99446.1
  • pagG
 11350 - 13422 (+) C-terminal cyanobactin protease/macrocyclase
copy AA seq
copy Nt seq
RiPP-specific information
Subclass Lanthipeptide
Cyclic? yes
Precursor genes
pagE7
Leader sequence: MTKKNLKPQQAAPVQREINTTSSESGTSTGLTPH
Core sequences:
  • QAYLGIPLP
pagE6
Leader sequence: MTKKNLKPQQAAPVQREINTTSSESGTSTGLTPH
Core sequences:
  • INPYLYP
Annotation changelog
MIBiG version Submitter Notes
1.0
  • Hidden contributor (ID: OVR6EKPL57AJOPBA4Z45OQI7, no GDPR consent given).
  • Submitted
2.0
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Migrated from v1.4
  • Updated compound(s) information (NPAtlas curation)
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.