Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000488.1:
Cluster 1RiPP111388

BGC0000488, circularin A biosynthetic gene cluster from Clostridium beijerinckii. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: circularin A
Exact molecular mass: 6771 Da (None)
Molecular activity: Antibacterial
Molecular target: membrane

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Head-to-tailcyclized peptide (cyclic)
Peptides in this cluster:
CAD97580.1
RiPP core peptide sequence(s): VAGALGVQTAAATTIVNVILNAGTLVTVLGIIASIASGGAGTLMTIGWATFKATVQKLAKQSMARAIAY
Leader peptide length: 3
Follower peptide length: 69
Cleavage recognition site sequence(s):
Peptidase(s) involved in precursor cleavage:

Gene cluster description

circularin A (BGC0000488). Gene Cluster 1. Biosynthetic class = RiPP. GenBank AJ566621, positions 1-11388. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Heterologous expression, Sequence-based prediction
MIxS-compliance:Unknown
Comments:Only partial expression data in Lactococcus or Enterococcus. No direct data on Clostridium. Same class as enterocin AS-48
Contact for this cluster:Oscar P. Kuipers (University of Groningen)

Literature references

1. Kemperman R et al. (2003) Functional analysis of the gene cluster involved in production of the bacteriocin circularin A by Clostridium beijerinckii ATCC 25752. Appl Environ Microbiol 69(10):5839-48.