Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000495.1:
Cluster 1RiPP138168

BGC0000495, actagardine biosynthetic gene cluster from Actinoplanes garbadinensis. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: actagardine
PubChem ID: 16132310
SMILES string: Copy to clipboard
Molecular formula: C81H132N20O23
Average molecular mass: 1754.064 Da

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lanthipeptide

Gene cluster description

Download cluster GenBank file
actagardine (BGC0000495). Gene Cluster 1. Biosynthetic class = RiPP. GenBank FJ547091. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

garA leader / core peptide, putative Class II
MSALAIEKSWKDVDLRDGATSHPAGLGFGELTFEDLREDRTIYAA - DhaDhaGWVCDhbLDhbIECGDhbVICAC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

Literature references

1. Boakes S et al. (2009) Organization of the genes encoding the biosynthesis of actagardine and engineering of a variant generation system. Mol Microbiol 72(5):1126-36. doi: 10.1111/j.1365-2958.2009.06708.x.