Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000502.1:
Cluster 1RiPP116018

BGC0000502, cerecidin / cerecidin A1 / cerecidin A2 / cerecidin A3 / cerecidin A4 / cerecidin A5 / cerecidin A6 / cerecidin A7 biosynthetic gene cluster from Bacillus cereus. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: cerecidin

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lanthipeptide

Gene cluster description

cerecidin / cerecidin A1 / cerecidin A2 / cerecidin A3 / cerecidin A4 / cerecidin A5 / cerecidin A6 / cerecidin A7 (BGC0000502). Gene Cluster 1. Biosynthetic class = RiPP. GenBank KJ000001. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

cerA7 leader / core peptide, putative Class II
MSKGYKFTKEELVEAWKDPQVREKLKDLPNHPSGKALNELSEEELAEIQGA - DhaDVQPEDhbDhbPLCVGVIIGIDhbADhaIKICK
cerA6 leader / core peptide, putative Class II
MSKGYKFTKEELVEAWKDPQVREKLNDLPKHPSGKALNELSEEELAEIQGA - DhaDVQPEDhbDhbPLCVGVIIGLDhbDhbDhaIKICK
cerA5 leader / core peptide, putative Class II
MSKGYKFTKEELVEAWKDPQVREKLNDLPKHPSGKALNELSEEELAEIQGA - DhaDVQPEDhbDhbPLCVGVIIGLDhbDhbDhaIKICK
cerA4 leader / core peptide, putative Class II
MSKGYKFTKEELVEAWKDPQVREKLKDLPKHPSGKALNELSEEELAEIQGA - DhaDVQPEDhbDhbPLCVGVIIGLDhbDhbDhaIKICK
cerA3 leader / core peptide, putative Class II
MSKGYKFTKEELVEAWKDPQVREKLNDLPKHPSGKALNELSEEELAEIQGA - DhaDVQPEDhbDhbPLCVGVIIGLDhbDhbDhaIKICK
cerA2 leader / core peptide, putative Class II
MSKGYKFTKEELVEAWKDPQVREKLKDLPKHPSGKALNELSEEELAEIQGA - DhaDVQPEDhbDhbPLCVGVIIGLDhbDhbDhaIKICK
cerA1 leader / core peptide, putative Class II
MSKGYKFTKEELVEAWKDPQVREKLKDLPKHPSGKALNELSEEELAEIQGA - DhaDVQPEDhbDhbPLCVGVIIGLDhbDhbDhaIKICK

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Literature references

1. Wang J et al. (2014) Cerecidins, novel lantibiotics from Bacillus cereus with potent antimicrobial activity. Appl Environ Microbiol 80(8):2633-43. doi: 10.1128/AEM.03751-13. Epub