Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000503.1:
Cluster 1RiPP117083

BGC0000503, cinnamycin biosynthetic gene cluster from Streptomyces cinnamoneus. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: Cinnamycin
PubChem ID: 135309121
SMILES string: Copy to clipboard
Molecular formula:
Average molecular mass: Da
Molecular activity: Antibacterial
Molecular target: Cell Wall, ethanolamine

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lantipeptide (cyclic)
Peptides in this cluster:
CINA
RiPP core peptide sequence(s): CRQSCSFGPFTFVCDGNTK
Leader peptide length: 59
Follower peptide length: -1
Peptidase(s) involved in precursor cleavage:
Crosslinks in final product:
1=18 AA (Thioether)
4=14 AA (Thioether)
5=11 AA (Thioether)
6=19 AA (Other)

Gene cluster description

cinnamycin (BGC0000503). Gene Cluster 1. Biosynthetic class = RiPP. GenBank AJ536588, positions 1223-15160. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

cinA leader / core peptide, putative Class II
MTASILQQSVVDADFRAALLENPAAFGASAAALPTPVEAQDQASLDFWTKDIAATEAFA - CRQDhaCDhaFGPFDhbFVCDGNDhbK

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Knock-out studies, Enzymatic assays, Heterologous expression, Sequence-based prediction, Other
MIxS-compliance:Unknown
Contact for this cluster:David Widdick (John Innes Centre)

Literature references

1. Widdick DA et al. (2003) Cloning and engineering of the cinnamycin biosynthetic gene cluster from Streptomyces cinnamoneus cinnamoneus DSM 40005. Proc Natl Acad Sci U S A 100(7):4316-21. doi:
2. Okesli A et al. (2011) Nine post-translational modifications during the biosynthesis of cinnamycin. J Am Chem Soc 133(34):13753-60. doi: 10.1021/ja205783f. Epub 2011