Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000506.1:
Cluster 1RiPP114098

BGC0000506, entianin biosynthetic gene cluster from Bacillus subtilis. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: Entianin
SMILES string: Copy to clipboard
Molecular formula: C150H231N39O38S5
Exact molecular mass: 3347.6 Da ([M+H]+)
Molecular activity: Antibacterial, Signalling

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lantipeptide (linear)
Peptides in this cluster:
ETNS
RiPP core peptide sequence(s): WKSESVCTPGCVTGLLQTCFLQTITCNCKISK
Leader peptide length: 24
Follower peptide length: 32
Peptidase(s) involved in precursor cleavage:

Gene cluster description

entianin (BGC0000506). Gene Cluster 1. Biosynthetic class = RiPP. GenBank HQ871873. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

etnS leader / core peptide, putative Class I
MSKFDDFDLDVVKVSKQDSKITPQ - WKDhaEDhaVCDhbPGCVDhbGLLQDhbCFLQDhbIDhbCNCKIDhaK

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Knock-out studies, Enzymatic assays, Heterologous expression, Gene expression correlated with compound production, Sequence-based prediction
MIxS-compliance:Unknown
Contact for this cluster:Prof. Dr. Karl-Dieter Entian (Goethe University )

Literature references

1. Fuchs SW et al. (2011) Entianin, a novel subtilin-like lantibiotic from Bacillus subtilis subsp. spizizenii DSM 15029T with high antimicrobial activity. Appl Environ Microbiol 77(5):1698-707. doi: 10.1128/AEM.01962-10. Epub
2. Bochmann SM et al. (2015) Synthesis and succinylation of subtilin-like lantibiotics are strongly influenced by glucose and transition state regulator AbrB. Appl Environ Microbiol 81(2):614-22. doi: 10.1128/AEM.02579-14. Epub