Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000508.1:
Cluster 1RiPP18700

BGC0000508, epidermin biosynthetic gene cluster from Staphylococcus epidermidis. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: epidermin
PubChem ID: 16132391
SMILES string: Copy to clipboard
Molecular formula: C98H141N25O23S4
Average molecular mass: 2165.598 Da

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lanthipeptide

Gene cluster description

epidermin (BGC0000508). Gene Cluster 1. Biosynthetic class = RiPP. GenBank X62386. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

epiA leader / core peptide, putative Class I
MEAVKEKNDLFNLDVKVNAKESNDSGAEPR - IADhaKFICDhbPGCAKDhbGDhaFNDhaYCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

Literature references

1. Schnell N et al. (1992) Analysis of genes involved in the biosynthesis of lantibiotic epidermin. Eur J Biochem 204(1):57-68.
2. Blahovec J, Ondrus I. (1975) [Determination of the proteolytic activity of beef liver by means of natural substrates labed with 125 I]. Vet Med (Praha) 20(7):399-406.