Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000514.1:
Cluster 1RiPP112705

BGC0000514, gallidermin biosynthetic gene cluster from Staphylococcus gallinarum. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: gallidermin
PubChem ID: 73348284
SMILES string: Copy to clipboard
Molecular formula: C98H141N25O23S4
Average molecular mass: 2165.598 Da

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lanthipeptide

Gene cluster description

gallidermin (BGC0000514). Gene Cluster 1. Biosynthetic class = RiPP. GenBank DQ367437. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

gdmA leader / core peptide, putative Class I
MEAVKEKNELFDLDVKVNAKESNDSGAEPR - IADhaKFLCDhbPGCAKDhbGDhaFNDhaYCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

Literature references

1. Valsesia G et al. (2007) Circumventing the effect of product toxicity: development of a novel two-stage production process for the lantibiotic gallidermin. Appl Environ Microbiol 73(5):1635-45. doi: 10.1128/AEM.01969-06. Epub