Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000515.1:
Cluster 1RiPP112631

BGC0000515, geobacillin I biosynthetic gene cluster from Geobacillus thermodenitrificans. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: geobacillin I
Molecular formula: C136H220N40O37S8
Exact molecular mass: 3262.5 Da ([M+H]+)
Molecular activity: Antibacterial
Molecular target: Binding to lipid II and pore formation

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lantipeptide (cyclic)
Peptides in this cluster:
RiPP core peptide sequence(s): VTSKSLCTPGCITGVLMCLTQNSCVSCNSCIRC
Leader peptide length: 23
Follower peptide length: -1
Cleavage recognition site sequence(s):
Peptidase(s) involved in precursor cleavage:
Crosslinks in final product:
3=7 AA (Thioether)
8=11 AA (Thioether)
13=18 AA (Thioether)
20=24 AA (Thioether)
23=27 AA (Thioether)
26=30 AA (Thioether)
29=33 AA (Thioether)

Gene cluster description

geobacillin I (BGC0000515). Gene Cluster 1. Biosynthetic class = RiPP. GenBank CP000557, positions 298823-311453. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

GTNG_0265 leader / core peptide, putative Class I
MAKFDDFDLDIVVKKQDDVVQPN - VDhbDhaKDhaLCDhbPGCIDhbGVLMCLDhbQNDhaCVDhaCNDhaCIRC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Enzymatic assays, Heterologous expression, Sequence-based prediction
MIxS-compliance:Unknown
Comments:Locus tags have been given to the genes described. As of now the genes have been given the automatic GeneID designation as either sunA, spaB and spaC. The entered GeneID designations are as follows: geoAI, geoB, geoC respectively to match what is reported in the literature.
Contact for this cluster:Wilfred Van Der Donk (The University of Illinois Urbana Champaign)

Literature references

1. Garg N et al. (2012) Lantibiotics from Geobacillus thermodenitrificans. Proc Natl Acad Sci U S A 109(14):5241-6. doi:
2. Garg N et al. (2014) Mode of action and structure-activity relationship studies of geobacillin I. J Antibiot (Tokyo) 67(1):133-6. doi: 10.1038/ja.2013.112. Epub 2013 Oct