BGC0000517: haloduracin β biosynthetic gene cluster from Bacillus halodurans C-125
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
View antiSMASH-generated output
Download Cluster GenBank file
Download region SVG
Location: 476,922 - 486,037 nt. (total: 9,116 nt).
This entry is originally from NCBI GenBank BA000004.3.

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
other genes
resistance
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
General
Compounds
Genes
RiPP
History
KnownClusterBlast
General information about the BGC
MIBiG accession BGC0000517
Short description haloduracin β biosynthetic gene cluster from Bacillus halodurans C-125
Status Minimal annotation: no
A minimal annotation only contains information on the BGC loci and one or more linked chemical product(s)

Completeness: complete
Whether the loci encodes everything needed for the pathway producing the compound(s)
Remarks "The lantibiotic synthetases complete dehydration and cyclization so reaction type was marked as other. "
Biosynthetic class(es)
  • RiPP (Lanthipeptide)
Loci NCBI GenBank: BA000004.3
Compounds
  • haloduracin β
  • haloduracin α
Species Bacillus halodurans C-125 [taxonomy]
References
Chemical products information
haloduracin β [synonyms: Hal beta]
(no structure information available)
C103H155N27O27S4
haloduracin α [synonyms: Hal alpha]
(no structure information available)
C130H196N36O37S6
List of genes involved in compound(s) production
Identifiers Position Product Functions Evidence Extra
  • BAB04170.1
  • BH0451
 476922 - 479096 (-) lantibiotic haloduracin protease and transporter
  • Unknown
Sequence-based prediction
copy AA seq
copy Nt seq
  • BAB04171.1
  • BH0452
 479086 - 482058 (-) Class II lantibiotic synthetase
  • Scaffold biosynthesis (Unknown)
Activity assay
Other in vivo study
Sequence-based prediction
copy AA seq
copy Nt seq
  • BAB04172.1
  • BH0453
 482191 - 482388 (-) lantibiotic haloduracin precursor
  • Precursor biosynthesis
Activity assay
Sequence-based prediction
copy AA seq
copy Nt seq
  • BAB04173.1
  • BH0454
 482580 - 482789 (+) lantibiotic haloduracin precursor
  • Precursor biosynthesis
Activity assay
Sequence-based prediction
copy AA seq
copy Nt seq
  • BAB04174.1
  • BH0455
 482858 - 486037 (+) Class II lantibiotic synthetase
  • Scaffold biosynthesis (Unknown)
Activity assay
Other in vivo study
Sequence-based prediction
copy AA seq
copy Nt seq
RiPP-specific information
Subclass Lanthipeptide
Cyclic? yes
Peptidases
    BH0451
Precursor genes
BH0454
Leader sequence: MTNLLKEWKMPLERTHNNSNPAGDIFQELEDQDILAGVNGA
Core sequences:
  • CAWYNISCRLGNKGAYCTLTVECMPSCN
Crosslinks:
  • 7x17 (Thioether)
  • 18x23 (Thioether)
  • 20x27 (Thioether)
Cleavage recognition sites:
  • GA
Annotation changelog
MIBiG version Submitter Notes
1.0
  • Hidden contributor (ID: ZMZXFLPDGFEHMQPX76IB4OQ3, no GDPR consent given).
  • Submitted
2.0
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Migrated from v1.4
3.1
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Update chemical activity to schema version 2.11
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.