Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000517.1:
Cluster 1RiPP19116

BGC0000517, haloduracin alpha / haloduracin beta biosynthetic gene cluster from Bacillus halodurans. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: Haloduracin beta
Molecular formula: C103H155N27O27S4
Exact molecular mass: 2330.05 Da ([M+H]+)
Molecular activity: Antibacterial, Inhibitor
Molecular target: cell wall- lipidII, pore forming

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lantipeptide (cyclic)
Peptides in this cluster:
BAB04173.1
RiPP core peptide sequence(s): CAWYNISCRLGNKGAYCTLTVECMPSCN
Leader peptide length: 41
Follower peptide length: -1
Cleavage recognition site sequence(s): GA
Peptidase(s) involved in precursor cleavage: BAB04170.1
Crosslinks in final product:
7=17 AA (Thioether)
18=23 AA (Thioether)
20=27 AA (Thioether)
BAB04172.1
RiPP core peptide sequence(s): GDVHAQTTWPCATVGVSVALCPTTKCTSQC
Leader peptide length: 41
Follower peptide length: -1
Cleavage recognition site sequence(s): GS, GDVHAQ
Peptidase(s) involved in precursor cleavage: BAB04170.1
Crosslinks in final product:
1=5 AA (Thioether)
11=15 AA (Thioether)
17=20 AA (Thioether)
21=24 AA (Thioether)

Gene cluster description

haloduracin alpha / haloduracin beta (BGC0000517). Gene Cluster 1. Biosynthetic class = RiPP. GenBank BA000004, positions 472000-586037. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

BH0453 leader / core peptide, putative Class II
MVNSKDLRNPEFRKAQGLQFVDEVNEKELSSLAGS - GDVHAQDhbDhbWPCADhbVGVDhaVALCPDhbDhbKCDhbDhaQC
BH0454 leader / core peptide, putative Class II
MTNLLKEWKMPLERTHNNSNPAGDIFQELEDQDILAG - VNGACAWYNIDhaCRLGNKGAYCDhbLDhbVECMPDhaCN

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Enzymatic assays, Heterologous expression, Proven expression in natural host, Sequence-based prediction
MIxS-compliance:Unknown
Comments:The lantibiotic synthetases complete dehydration and cyclization so reaction type was marked as other.
Contact for this cluster:Wilfred Van Der Donk (The University of Illinois at Urbana-Champaign)

Literature references

1. McClerren AL et al. (2006) Discovery and in vitro biosynthesis of haloduracin, a two-component lantibiotic. Proc Natl Acad Sci U S A 103(46):17243-8. doi:
2. Lawton EM et al. (2007) Identification of a novel two-peptide lantibiotic, haloduracin, produced by the alkaliphile Bacillus halodurans C-125. FEMS Microbiol Lett 267(1):64-71. doi:
3. Cooper LE et al. (2008) Structure-activity relationship studies of the two-component lantibiotic haloduracin. Chem Biol 15(10):1035-45. doi: 10.1016/j.chembiol.2008.07.020.
4. Oman TJ, van der Donk WA. (2009) Insights into the mode of action of the two-peptide lantibiotic haloduracin. ACS Chem Biol 4(10):865-74. doi: 10.1021/cb900194x.
5. Oman TJ et al. (2011) Haloduracin alpha binds the peptidoglycan precursor lipid II with 2:1 stoichiometry. J Am Chem Soc 133(44):17544-7. doi: 10.1021/ja206281k. Epub 2011 Oct