Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000521.1:
Cluster 1RiPP112132

BGC0000521, lacticin 481 biosynthetic gene cluster from Lactococcus lactis. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: lacticin 481

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lanthipeptide

Gene cluster description

lacticin 481 (BGC0000521). Gene Cluster 1. Biosynthetic class = RiPP. GenBank U91581. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

lctA leader / core peptide, putative Class II
MKEQNSFNLLQEVTESELDLILGA - KGGDhaGVIHDhbIDhaHECNMNDhaWQFVFDhbCCDha
AAC72262.1 leader / core peptide, putative Class II
MKLENLFIEKLHGIYNYDVDFNEDITFLYG - DhaNGCG

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

Literature references

1. Rince A et al. (1994) Cloning, expression, and nucleotide sequence of genes involved in production of lactococcin DR, a bacteriocin from lactococcus lactis subsp. lactis. Appl Environ Microbiol 60(5):1652-7.
2. Rince A et al. (1997) Characterization of the lacticin 481 operon: the Lactococcus lactis genes lctF, lctE, and lctG encode a putative ABC transporter involved in bacteriocin immunity. Appl Environ Microbiol 63(11):4252-60.
3. Uguen P et al. (2000) Lantibiotic biosynthesis: interactions between prelacticin 481 and its putative modification enzyme, LctM. J Bacteriol 182(18):5262-6.
4. Dufour A et al. (2000) IS1675, a novel lactococcal insertion element, forms a transposon-like structure including the lacticin 481 lantibiotic operon. J Bacteriol 182(19):5600-5.