Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000527.1:
Cluster 1RiPP112324

BGC0000527, mersacidin biosynthetic gene cluster from Bacillus sp. HIL-Y85/54728. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: mersacidin
PubChem ID: 16132433
SMILES string: Copy to clipboard
Molecular formula: C80H128N20O21S4
Average molecular mass: 1834.263 Da

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lanthipeptide

Gene cluster description

mersacidin (BGC0000527). Gene Cluster 1. Biosynthetic class = RiPP. GenBank AJ250862. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

mrsA leader / core peptide, putative Class II
MSQEAIIRSWKDPFSRENSTQNPAGNPFSELKEAQMDKLVGA - GDMEAACDhbFDhbLPGGGGVCDhbLDhbDhaECIC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

Literature references

1. Altena K et al. (2000) Biosynthesis of the lantibiotic mersacidin: organization of a type B lantibiotic gene cluster. Appl Environ Microbiol 66(6):2565-71.
2. Gostin LO. (1990) The AIDS litigation project. A national review of court and human rights commission decisions, Part II: Discrimination. JAMA 263(15):2086-93.