Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000528.1:
Cluster 1RiPP18183

BGC0000528, michiganin A biosynthetic gene cluster from Clavibacter michiganensis. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: michiganin A

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lanthipeptide

Gene cluster description

michiganin A (BGC0000528). Gene Cluster 1. Biosynthetic class = RiPP. GenBank AM711867, positions 2216380-2224562. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

CMM_1967 leader / core peptide, putative Class II
MNDILETETPVMVSPRWDMLLDAGEDTSPSVQTQIDAEFRRVVSPYM - DhaDhaDhaGWLCDhbLDhbIECGDhbIICACR

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

Literature references

1. Holtsmark I et al. (2006) Purification, characterization, and gene sequence of michiganin A, an actagardine-like lantibiotic produced by the tomato pathogen Clavibacter michiganensis subsp. michiganensis. Appl Environ Microbiol 72(9):5814-21. doi: 10.1128/AEM.00639-06.