Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000530.1:
Cluster 1RiPP110118

BGC0000530, mutacin B-Ny266 biosynthetic gene cluster from Streptococcus mutans. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: mutacin B-Ny266

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lanthipeptide

Gene cluster description

mutacin B-Ny266 (BGC0000530). Gene Cluster 1. Biosynthetic class = RiPP. GenBank AHSM01000014, positions 36531-46648. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

SMU76_03160 leader / core peptide, putative Class I
MSNTQLLEVLGTETFDVQENLFTFDTTDTIVAESNDDPDTR - FKDhaWDhaFCDhbPGCAKDhbGDhaFNDhaYCC
SMU76_03165 leader / core peptide, putative Class I
MLNTQLLELFLSDTLDVREDLFDLNITDTAVIQSNDSPDTR - DhaRVGDhaHDhaICPPRKDhbDhaADhaFNDhaYCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

Literature references

1. Mota-Meira M et al. (1997) Purification and structure of mutacin B-Ny266: a new lantibiotic produced by Streptococcus mutans. FEBS Lett 410(2-3):275-9.