Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000531.1:
Cluster 1RiPP19746

BGC0000531, mutacin I biosynthetic gene cluster from Streptococcus mutans. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: mutacin I

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lanthipeptide

Gene cluster description

mutacin I (BGC0000531). Gene Cluster 1. Biosynthetic class = RiPP. GenBank AF238860. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

mutA leader / core peptide, putative Class I
MSNTQLLEVLGTETFDVQEDLFAFDTTDTTIVASNDDPDTR - FDhaDhaLDhaLCDhaLGCDhbGVKNPDhaFNDhaYCC
mutA_ leader / core peptide, putative Class I
MLNTQLLEVLGTKTFDVQEDLFEFNITDTIVLQASDSPDTH - DhaKVGDhaFDhaICPPRKDhbDhaVDhaFNDhaYCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

Literature references

1. Qi F et al. (2000) Purification and biochemical characterization of mutacin I from the group I strain of Streptococcus mutans, CH43, and genetic analysis of mutacin I biosynthesis genes. Appl Environ Microbiol 66(8):3221-9.