Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000533.1:
Cluster 1RiPP110050

BGC0000533, mutacin III biosynthetic gene cluster from Streptococcus mutans. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: mutacin III

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lanthipeptide

Gene cluster description

mutacin III (BGC0000533). Gene Cluster 1. Biosynthetic class = RiPP. GenBank AF154675. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

mutA leader / core peptide, putative Class I
MSNTQLLEVLGTETFDVQEDLFAFDTTDTTIVASNDDPDTR - FKDhaWDhaLCDhbPGCARDhbGDhaFNDhaYCC
mutA_ leader / core peptide, putative Class I
MLNTQLLEVLGTKTFDVQEDLFEFNITDTIVLQASDSPDTH - DhaKVGDhaFNICPPRKIDhaVDhaFNDhaYCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

Literature references

1. Qi F et al. (1999) Purification of mutacin III from group III Streptococcus mutans UA787 and genetic analyses of mutacin III biosynthesis genes. Appl Environ Microbiol 65(9):3880-7.