Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000544.1:
Cluster 1RiPP115581

BGC0000544, planosporicin biosynthetic gene cluster from Planomonospora alba. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: planosporicin
SMILES string: Copy to clipboard
Molecular formula: C90 H125 N27 O28 S5
Exact molecular mass: 2191.79 Da ([M+H]+)
Molecular activity: Antibacterial
Molecular target: Lipid II, blocks cell-wall biosynthesis

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lantipeptide (linear)
Peptides in this cluster:
CCQ18695
RiPP core peptide sequence(s): ITSVSWCTPGCTSEGGGSGCSHCC
Leader peptide length: 32
Follower peptide length: -1
Recognition motif in leader peptide for modification: FQLD
Peptidase(s) involved in precursor cleavage:
Crosslinks in final product:
3=7 AA (Thioether)
8=11 AA (Thioether)
13=20 AA (Thioether)
18=23 AA (Thioether)
21=24 AA (Thioether)

Gene cluster description

planosporicin (BGC0000544). Gene Cluster 1. Biosynthetic class = RiPP. GenBank HF570921, positions 14970-30259. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

pspA leader / core peptide, putative Class I
MGISSPALPQNTADLFQLDLEIGVEQSLASPA - IDhbDhaVDhaWCDhbPGCDhbDhaEGGGDhaGCDhaHCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Knock-out studies, Heterologous expression, Sequence-based prediction
MIxS-compliance:Unknown
Contact for this cluster:Margherita Sosio and Lorena T. Fernandez-Martinez (Naicons Srl and John Innes Centre; Norwich Research Park; Norwich; NR4 7UH; United Kingdom)

Literature references

1. Sherwood EJ et al. (2013) Cloning and analysis of the planosporicin lantibiotic biosynthetic gene cluster of Planomonospora alba. J Bacteriol 195(10):2309-21. doi: 10.1128/JB.02291-12. Epub 2013 Mar 8.
2. Sherwood EJ, Bibb MJ. (2013) The antibiotic planosporicin coordinates its own production in the actinomycete Planomonospora alba. Proc Natl Acad Sci U S A 110(27):E2500-9. doi:
3. Maffioli SI et al. (2009) Structure revision of the lantibiotic 97518. J Nat Prod 72(4):605-7. doi: 10.1021/np800794y.
4. Vasile F et al. (2012) Solution structure by nuclear magnetic resonance of the two lantibiotics 97518 and NAI-107. J Pept Sci 18(2):129-34. doi: 10.1002/psc.1425. Epub 2011 Nov 14.
5. Castiglione F et al. (2007) A novel lantibiotic acting on bacterial cell wall synthesis produced by the uncommon actinomycete Planomonospora sp. Biochemistry 46(20):5884-95. doi: 10.1021/bi700131x. Epub 2007 May