Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000554.1:
Cluster 1RiPP16546

BGC0000554, SRO15-3108 biosynthetic gene cluster from Streptomyces roseosporus. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: SRO15-3108
Exact molecular mass: 3108.3 Da (None)
Molecular activity: Unknown

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lantipeptide (cyclic)
Peptides in this cluster:
SSGG_RS13165/WP_006126649.1
RiPP core peptide sequence(s): TTWACATVTLTVTVCSPTGTLCGSCSMGTRGCC
Leader peptide length: 40
Follower peptide length: 0
Cleavage recognition site sequence(s): GG
Peptidase(s) involved in precursor cleavage: ssgg_rs13150, wp_006126653.1
Crosslinks in final product:
- Thioether

Gene cluster description

SRO15-3108 (BGC0000554). Gene Cluster 1. Biosynthetic class = RiPP. GenBank NZ_DS999644, positions 4445108-4451653. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

SSGG_RS13165 leader / core peptide, putative Class II
MNLVRAWKDPEYRATLSEAPANPAGLVELADDQLDGVAGG - DhbDhbWACADhbVDhbLDhbVDhbVCDhaPDhbGDhbLCGDhaCDhaMGDhbRGCC
SSGG_RS13160 leader / core peptide, putative Class II
MDIVRSWKDADYRLSLGSEAPAHPSGEGLTAITDEELTEINGA - GDhaGVLGDhbLGCCDhaCLPWYDhaGWDhbVCGLACNPGKPCKN

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Sequence-based prediction
MIxS-compliance:Unknown
Comments:There is a second propeptide with locus tag SSGG_RS13160, the production of which was not observed during extraction of solid culture. The sequence is MDIVRSWKDADYRLSLGSEAPAHPSGEGLTAITDEELTEINGAGSGVLGTLGCCSCLPWYSGWTVCGLACNPGKPCKN
Contact for this cluster:Neha Garg (University of California at San Diego)

Literature references

1. Kersten RD et al. (2011) A mass spectrometry-guided genome mining approach for natural product peptidogenomics. Nat Chem Biol 7(11):794-802. doi: 10.1038/nchembio.684.