BGC0000554: SRO15-3108 biosynthetic gene cluster from Streptomyces filamentosus NRRL 15998
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
Location: 4,445,108 - 4,451,653 nt. (total: 6,546 nt).
This entry is originally from NCBI GenBank NZ_DS999644.1.


core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
General information about the BGC
MIBiG accession BGC0000554
Short description SRO15-3108 biosynthetic gene cluster from Streptomyces filamentosus NRRL 15998
Status Minimal annotation: no
A minimal annotation only contains information on the BGC loci and one or more linked chemical product(s)

Completeness: complete
Whether the loci encodes everything needed for the pathway producing the compound(s)
Remarks "There is a second propeptide with locus tag SSGG_RS13160, the production of which was not observed during extraction of solid culture. The sequence is MDIVRSWKDADYRLSLGSEAPAHPSGEGLTAITDEELTEINGAGSGVLGTLGCCSCLPWYSGWTVCGLACNPGKPCKN\n"
Biosynthetic class(es)
  • RiPP (Lanthipeptide)
Loci NCBI GenBank: NZ_DS999644.1
  • SRO15-3108
Species Streptomyces filamentosus NRRL 15998 [taxonomy]
Chemical products information
(no structure information available)
List of genes involved in compound(s) production
Identifiers Position Product Functions Evidence Extra
  • SSGG_RS13165
  • WP_006126649.1
4445108 - 4445329 (+) mersacidin/lichenicidin family type 2 lantibiotic
copy AA seq
copy Nt seq
  • SSGG_RS13160
  • WP_010071700.1
4445362 - 4445598 (+) mersacidin/lichenicidin family type 2 lantibiotic
copy AA seq
copy Nt seq
  • SSGG_RS13155
  • WP_010071701.1
  • lanM
4445688 - 4449002 (+) type 2 lantipeptide synthetase LanM
copy AA seq
copy Nt seq
  • SSGG_RS37390
  • WP_006126652.1
4449318 - 4449509 (+) hypothetical protein
copy AA seq
copy Nt seq
  • SSGG_RS13150
  • WP_010071703.1
4449506 - 4451653 (+) peptidase domain-containing ABC transporter
copy AA seq
copy Nt seq
RiPP-specific information
Subclass Lanthipeptide
Cyclic? yes
  • wp_006126653.1
  • SSGG_RS13150
Annotation changelog
MIBiG version Submitter Notes
  • Hidden contributor (ID: UK5BZZ5BLXFR5LGS2GITT5IB, no GDPR consent given).
  • Submitted
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Migrated from v1.4
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.

No matches found.