Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000555.1:
Cluster 1RiPP111750

BGC0000555, staphylococcin C55 alpha / staphylococcin C55 beta biosynthetic gene cluster from Staphylococcus aureus. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: staphylococcin C55 alpha

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lanthipeptide

Gene cluster description

staphylococcin C55 alpha / staphylococcin C55 beta (BGC0000555). Gene Cluster 1. Biosynthetic class = RiPP. GenBank AP003088, positions 24101-35850. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

BAB78438.1 leader / core peptide, putative Class II
MKSSFLEKDIEEQVTWFEEVSEQEFDDDIFGA - CDhaDhbNDhbFDhaLDhaDYWGNKGNWCDhbADhbHECMDhaWCK
BAB78439.1 leader / core peptide, putative Class II
MKNELGKFLEENELELGKFSESDMLEITDDEVYAA - GDhbPLALLGGAADhbGVIGYIDhaNQDhbCPDhbDhbACDhbRAC
BAB78446.1 leader / core peptide, putative Class II
MSALNWFILFVISAMLGSFAASILDNIMQS - IWIPRICGGLVAALVGGFLYLFFDhbNEK

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Literature references

1. Navaratna MA et al. (1999) Identification of genes encoding two-component lantibiotic production in Staphylococcus aureus C55 and other phage group II S. aureus strains and demonstration of an association with the exfoliative toxin B gene. Infect Immun 67(8):4268-71.