Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000559.1:
Cluster 1RiPP114616

BGC0000559, subtilin biosynthetic gene cluster from Bacillus subtilis. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: Subtilin
SMILES string: Copy to clipboard
Molecular formula: C148H227N39O38S5
Exact molecular mass: 3319.6 Da ([M+H]+)
Molecular activity: Antibacterial, Signalling

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lantipeptide (linear)
Peptides in this cluster:
SPAS
RiPP core peptide sequence(s): WKSESLCTPGCVTGALQTCFLQTLTCNCKISK
Leader peptide length: 24
Follower peptide length: 32
Peptidase(s) involved in precursor cleavage:

Gene cluster description

subtilin (BGC0000559). Gene Cluster 1. Biosynthetic class = RiPP. GenBank U09819. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

spaS leader / core peptide, putative Class I
MSKFDDFDLDVVKVSKQDSKITPQ - WKDhaEDhaLCDhbPGCVDhbGALQDhbCFLQDhbLDhbCNCKIDhaK

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Knock-out studies, Enzymatic assays, Heterologous expression, Gene expression correlated with compound production, Sequence-based prediction
MIxS-compliance:Unknown
Contact for this cluster:Prof. Dr. Karl-Dieter Entian (Goethe Universitaet Frankfurt am Main)

Literature references

1. Sottong P et al. (1976 TI) Purification of herpesvirus nucleocapsids by fluorocarbon extraction. Microbios 16(64):105-10.
2. Detwiler PB. (1976) Multiple light-evoked conductance changes in the photoreceptors of Hermissenda crassicornis. J Physiol 256(3):691-708.
3. Atkins D et al. (1977) Secretion of prostaglandins as bone-resorbing agents by renal cortical carcinoma in culture. Br J Cancer 36(5):601-7.
4. Beggs JD, Fewson CA. (1977) Regulation of synthesis of benzyl alcohol dehydrogenase in Acinetobacter calcoaceticus NCIB8250. J Gen Microbiol 103(1):127-40. doi: 10.1099/00221287-103-1-127.
5. Draudin-Krylenko VA. (1977) [Pyridoxal kinase activity in human tumor tissues]. Vopr Med Khim 23(5):592-6.
6. Stein T et al. (2002) Dual control of subtilin biosynthesis and immunity in Bacillus subtilis. Mol Microbiol 44(2):403-16.
7. Stein T et al. (2003) The spa-box for transcriptional activation of subtilin biosynthesis and immunity in Bacillus subtilis. Mol Microbiol 47(6):1627-36.
8. Corvey C et al. (2003) Activation of subtilin precursors by Bacillus subtilis extracellular serine proteases subtilisin (AprE), WprA, and Vpr. Biochem Biophys Res Commun 304(1):48-54.
9. Bochmann SM et al. (2015) Synthesis and succinylation of subtilin-like lantibiotics are strongly influenced by glucose and transition state regulator AbrB. Appl Environ Microbiol 81(2):614-22. doi: 10.1128/AEM.02579-14. Epub
10. Klein C et al. (1993) Biosynthesis of the lantibiotic subtilin is regulated by a histidine kinase/response regulator system. Appl Environ Microbiol 59(1):296-303.
11. Klein C et al. (1992) Analysis of genes involved in biosynthesis of the lantibiotic subtilin. Appl Environ Microbiol 58(1):132-42.
12. Klein C, Entian KD. (1994) Genes involved in self-protection against the lantibiotic subtilin produced by Bacillus subtilis ATCC 6633. Appl Environ Microbiol 60(8):2793-801.