Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000566.1:
Cluster 1RiPP18290

BGC0000566, streptolysin S biosynthetic gene cluster from Streptococcus pyogenes. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: Streptolysin S
Molecular activity: Cytotoxic

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
LAP (linear)
Peptides in this cluster:
SPY_0738
RiPP core peptide sequence(s): CCCCCTTCCFSIATGSGNSQGGSGSYTPGK
Leader peptide length: 23
Follower peptide length: -1
Recognition motif in leader peptide for modification: FxxxI
Peptidase(s) involved in precursor cleavage: spy_0742

Gene cluster description

streptolysin S (BGC0000566). Gene Cluster 1. Biosynthetic class = RiPP. GenBank AE004092, positions 598682-606971. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Homologous known gene clusters

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Knock-out studies, Enzymatic assays, Heterologous expression
MIxS-compliance:Unknown
Contact for this cluster:Professor Douglas Mitchell (University of Illinois at Urbana-Champaign)

Literature references

1. Nizet V et al. (2000) Genetic locus for streptolysin S production by group A streptococcus. Infect Immun 68(7):4245-54.
2. Datta V et al. (2005) Mutational analysis of the group A streptococcal operon encoding streptolysin S and its virulence role in invasive infection. Mol Microbiol 56(3):681-95. doi: 10.1111/j.1365-2958.2005.04583.x.
3. Lee SW et al. (2008) Discovery of a widely distributed toxin biosynthetic gene cluster. Proc Natl Acad Sci U S A 105(15):5879-84. doi:
4. Mitchell DA et al. (2009) Structural and functional dissection of the heterocyclic peptide cytotoxin streptolysin S. J Biol Chem 284(19):13004-12. doi: 10.1074/jbc.M900802200. Epub 2009
5. Molloy EM et al. (2011) Streptolysin S-like virulence factors: the continuing sagA. Nat Rev Microbiol 9(9):670-81. doi: 10.1038/nrmicro2624.
6. Markley AL et al. (2012) An Escherichia coli-based bioengineering strategy to study streptolysin S biosynthesis. Anal Biochem 420(2):191-3. doi: 10.1016/j.ab.2011.09.020. Epub 2011