Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000592.1:
Cluster 1RiPP19997

BGC0000592, microviridin B biosynthetic gene cluster from Microcystis aeruginosa. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: Microviridin B
SMILES string: Copy to clipboard
Molecular formula: C84H106N16O24
Exact molecular mass: 1723.8332 Da (Molecular ion)
Molecular activity: Inhibitor
Molecular target: elastase

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Microviridin (cyclic)
Peptides in this cluster:
CAQ16116/MDNA
RiPP core peptide sequence(s): MAYPNDQQGKALPFFARFLSVSKEESSIKSPSPEPTFGTTLKYPSDWEEY
Leader peptide length: 36
Follower peptide length: -1
Cleavage recognition site sequence(s): PFFARFL
Peptidase(s) involved in precursor cleavage:
Crosslinks in final product:
4=10 AA (Lactone)
6=13 AA (Lactam)
9=12 AA (Lactone)

Gene cluster description

microviridin B (BGC0000592). Gene Cluster 1. Biosynthetic class = RiPP. GenBank AM943877. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Homologous known gene clusters

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Heterologous expression
MIxS-compliance:Unknown
Contact for this cluster:Nadine Ziemert (University of Tuebingen)

Literature references

1. Ziemert N et al. (2008 TI) Ribosomal synthesis of tricyclic depsipeptides in bloom-forming cyanobacteria. Angew Chem Int Ed Engl 47(40):7756-9. doi: 10.1002/anie.200802730.
2. Weiz AR et al. (2011) Leader peptide and a membrane protein scaffold guide the biosynthesis of the tricyclic peptide microviridin. Chem Biol 18(11):1413-21. doi: 10.1016/j.chembiol.2011.09.011.