Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000607.1:
Cluster 1RiPP124009

BGC0000607, micrococcin P1 biosynthetic gene cluster from Macrococcus caseolyticus. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: micrococcin P1
PubChem ID: 6446886
SMILES string: Copy to clipboard
Molecular formula: C48H49N13O9S6
Average molecular mass: 1144.362 Da

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Thiopeptide

Gene cluster description

micrococcin P1 (BGC0000607). Gene Cluster 1. Biosynthetic class = RiPP. GenBank KM613043. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

tclE leader / core peptide, putative Class I
MSEFQTNNIEGLDVTDLEFISEEVTEKDEKEIM - GADhaCDhbDhbCVCDhbCDhaCCDhbDhb

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

Literature references

1. Bennallack PR et al. (2014) Characterization of a novel plasmid-borne thiopeptide gene cluster in Staphylococcus epidermidis strain 115. J Bacteriol 196(24):4344-50. doi: 10.1128/JB.02243-14. Epub 2014 Oct