Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000616.1:
Cluster 1RiPP14173

BGC0000616, amylocyclicin biosynthetic gene cluster from Bacillus amyloliquefaciens. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: amylocyclicin
Exact molecular mass: 6381 Da (None)
Molecular activity: Antibacterial

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Head-to-tailcyclized peptide (cyclic)
Peptides in this cluster:
RBAM_029230
RiPP core peptide sequence(s): LASTLGISTAAAKKAIDIIDAASTIASIISLIGIVTGAGAISYAIVATAKTMIKKYGKKYAAAW
Leader peptide length: 48
Follower peptide length: 64
Cleavage recognition site sequence(s): ANAE
Peptidase(s) involved in precursor cleavage:
Crosslinks in final product:
1=64 AA (Other)

Gene cluster description

amylocyclicin (BGC0000616). Gene Cluster 1. Biosynthetic class = RiPP. GenBank CP000560, positions 3044506-3048678. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Knock-out studies, Sequence-based prediction
MIxS-compliance:Unknown
Contact for this cluster:Rainer Borriss (Humboldt-Universitat zu Berlin)

Literature references

1. Scholz R et al. (2014) Amylocyclicin, a novel circular bacteriocin produced by Bacillus amyloliquefaciens FZB42. J Bacteriol 196(10):1842-52. doi: 10.1128/JB.01474-14. Epub 2014 Mar 7.