Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0001157.1:
Cluster 1RiPP117167

BGC0001157, bottromycin biosynthetic gene cluster from Streptomyces scabiei. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: Bottromycin A2
PubChem ID: 3081434
ChemSpider ID: 26365309
SMILES string: Copy to clipboard
Molecular formula: C42H62N8O7S
Average molecular mass: 823.067 Da
Molecular activity: Antibacterial
Molecular target: Ribosome

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Bottromycin (cyclic)
Peptides in this cluster:
CBG72694/SCAB_56681
RiPP core peptide sequence(s): MGPVVVFDCMTADFLNDDPNNAELSALEMEELESWGAWDGEATS
Leader peptide length: 1
Follower peptide length: 35
Peptidase(s) involved in precursor cleavage:
Crosslinks in final product:
2=5 AA (Other)

Gene cluster description

bottromycin (BGC0001157). Gene Cluster 1. Biosynthetic class = RiPP. GenBank FN554889, positions 6321700-6304534. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Homologous known gene clusters

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Knock-out studies, Sequence-based prediction
MIxS-compliance:Unknown
Contact for this cluster:Andrew Truman (John Innes Centre)

Literature references

1. Shimamura H et al. (2009 TI) Structure determination and total synthesis of bottromycin A2: a potent antibiotic against MRSA and VRE. Angew Chem Int Ed Engl 48(5):914-7. doi: 10.1002/anie.200804138.
2. Otaka T, Kaji A. (1976) Mode of action of bottromycin A2. Release of aminoacyl- or peptidyl-tRNA from ribosomes. J Biol Chem 251(8):2299-306.
3. William J. K. Crone, Finian J. Leeper, Andrew W. Truman. (2012) Identification and characterisation of the gene cluster for the anti-MRSA antibiotic bottromycin: expanding the biosynthetic diversity of ribosomal peptides. Chemical Science, vol. 3, no. 12, p. 3516