Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0001210.1:
Cluster 1RiPP19235

BGC0001210, pseudomycoicidin biosynthetic gene cluster from Bacillus pseudomycoides. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: pseudomycoicidin

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Other

Gene cluster description

pseudomycoicidin (BGC0001210). Gene Cluster 1. Biosynthetic class = RiPP. GenBank CM000745, positions 4366121-4375355. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

bpmyx0001_45460 leader / core peptide, putative Class II
MNDKIIQYWNDPAKRSTLSAAELSKMPVNPAGDILAELSDADLDKVVGA - GDCGGDhbCDhbWDhbKDCDhaICPDhaWDhaCWDhaWDhaC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Literature references

1. Basi-Chipalu S et al. (2015) Pseudomycoicidin, a Class II Lantibiotic from Bacillus pseudomycoides. Appl Environ Microbiol 81(10):3419-29. doi: 10.1128/AEM.00299-15.