Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0001226.1:
Cluster 1RiPP16018
The following clusters are from record BGC0001226.2:
Cluster 2RiPP16018

BGC0001226, streptocollin biosynthetic gene cluster from Streptomyces collinus. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: streptocollin
Exact molecular mass: 1064.2 Da ([M+2H]2+)
Molecular activity: Unknown, Inhibitor
Molecular target: protein tyrosine phosphatase 1B (PTP1B)

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lanthipeptide (linear)
Peptides in this cluster:
B446_00784
RiPP core peptide sequence(s): MENQTLELLAHLHALPETDPVDFDGASYSGTCACVGLLTLLNTVCVGISCA
Leader peptide length: 28
Follower peptide length: -1
Peptidase(s) involved in precursor cleavage:
Crosslinks in final product:
3=22 AA (Thioether)
4=15 AA (Thioether)
6=11 AA (Thioether)
17=21 AA (Thioether)
B446_34506
RiPP core peptide sequence(s): MENQTLELLAHLHALPETDPVDFDGASYSGTCACVGLLTLLNTVCVGISCA
Leader peptide length: 28
Follower peptide length: -1
Peptidase(s) involved in precursor cleavage:
Crosslinks in final product:
3=22 AA (Thioether)
4=15 AA (Thioether)
6=11 AA (Thioether)
17=21 AA (Thioether)

Gene cluster description

streptocollin (BGC0001226). Gene Cluster 1. Biosynthetic class = RiPP. GenBank CP006259, positions 182318-189114. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

No core peptides found.

Homologous known gene clusters

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Heterologous expression, Gene expression correlated with compound production, Sequence-based prediction
MIxS-compliance:Unknown
Contact for this cluster:Tilmann Weber (Technical University of Denmark)

Literature references

1. Iftime D et al. (2015) Streptocollin, a Type IV Lanthipeptide Produced by Streptomyces collinus Tu 365. Chembiochem 16(18):2615-23. doi: 10.1002/cbic.201500377. Epub 2015 Nov
2. Iftime D et al. (2016) Identification and activation of novel biosynthetic gene clusters by genome mining in the kirromycin producer Streptomyces collinus Tu 365. J Ind Microbiol Biotechnol 43(2-3):277-91. doi:

BGC0001226, streptocollin biosynthetic gene cluster from Streptomyces collinus. Locus 2. Full MIBiG entry.

Chemical compounds

Compound: streptocollin
Exact molecular mass: 1064.2 Da ([M+2H]2+)
Molecular activity: Unknown, Inhibitor
Molecular target: protein tyrosine phosphatase 1B (PTP1B)

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lanthipeptide (linear)
Peptides in this cluster:
B446_00784
RiPP core peptide sequence(s): MENQTLELLAHLHALPETDPVDFDGASYSGTCACVGLLTLLNTVCVGISCA
Leader peptide length: 28
Follower peptide length: -1
Peptidase(s) involved in precursor cleavage:
Crosslinks in final product:
3=22 AA (Thioether)
4=15 AA (Thioether)
6=11 AA (Thioether)
17=21 AA (Thioether)
B446_34506
RiPP core peptide sequence(s): MENQTLELLAHLHALPETDPVDFDGASYSGTCACVGLLTLLNTVCVGISCA
Leader peptide length: 28
Follower peptide length: -1
Peptidase(s) involved in precursor cleavage:
Crosslinks in final product:
3=22 AA (Thioether)
4=15 AA (Thioether)
6=11 AA (Thioether)
17=21 AA (Thioether)

Gene cluster description

streptocollin (BGC0001226). Gene Cluster 2. Biosynthetic class = RiPP. GenBank CP006259, positions 182318-189114. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

No core peptides found.

Homologous known gene clusters

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Heterologous expression, Gene expression correlated with compound production, Sequence-based prediction
MIxS-compliance:Unknown
Contact for this cluster:Tilmann Weber (Technical University of Denmark)

Literature references

1. Iftime D et al. (2015) Streptocollin, a Type IV Lanthipeptide Produced by Streptomyces collinus Tu 365. Chembiochem 16(18):2615-23. doi: 10.1002/cbic.201500377. Epub 2015 Nov
2. Iftime D et al. (2016) Identification and activation of novel biosynthetic gene clusters by genome mining in the kirromycin producer Streptomyces collinus Tu 365. J Ind Microbiol Biotechnol 43(2-3):277-91. doi: