BGC0001229: SBI-06990 A1 biosynthetic gene cluster from Streptomyces bingchenggensis BCW-1
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
Location: 8,356,685 - 8,365,315 nt. (total: 8,631 nt).
This entry is originally from NCBI GenBank CP002047.1.

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
other genes
resistance
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
General
Compounds
Genes
RiPP
History
KnownClusterBlast
General information about the BGC
MIBiG accession BGC0001229
Short description SBI-06990 A1 biosynthetic gene cluster from Streptomyces bingchenggensis BCW-1
Status Minimal annotation: no
A minimal annotation only contains information on the BGC loci and one or more linked chemical product(s)

Completeness: complete
Whether the loci encodes everything needed for the pathway producing the compound(s)
Remarks "The protease encoded in the two component lanthipeptide cluster is fused with a second lanthionine synthetase, LanM in the same orf SBI_06987"
Biosynthetic class(es)
  • RiPP (Lanthipeptide)
Loci NCBI GenBank: CP002047.1
Compounds
  • SBI-06990 A1
  • SBI-06989 A2
Species Streptomyces bingchenggensis BCW-1 [taxonomy]
References
Chemical products information
SBI-06990 A1 [synonyms: bingicin alpha]
(no structure information available)
SBI-06989 A2 [synonyms: bingicin beta]
(no structure information available)
List of genes involved in compound(s) production
Identifiers Position Product Functions Evidence Extra
  • SBI_06987
  • ADI10107.1
8356685 - 8361721 (-) type II lanthionine synthetase and transporter
  • Tailoring (Unknown)
Sequence-based prediction
copy AA seq
copy Nt seq
  • SBI_06988
  • ADI10108.1
8361723 - 8364764 (-) type II lanthionine synthetase
  • Tailoring (Unknown)
Sequence-based prediction
copy AA seq
copy Nt seq
  • SBI_06989
  • ADI10109.1
8364893 - 8365087 (-) lanthipeptide beta
  • Precursor biosynthesis
Sequence-based prediction
copy AA seq
copy Nt seq
  • SBI_06990
  • ADI10110.1
8365112 - 8365315 (-) lanthipeptide alpha
  • Precursor biosynthesis
Sequence-based prediction
copy AA seq
copy Nt seq
RiPP-specific information
Subclass Lanthipeptide
Cyclic? yes
Peptidases
  • SBI_06987
Precursor genes
>SBI_06990
Leader sequence: MHQEFEGDISLVEELAEQDLHDAAQHGG
Core sequences:
  • TISPIDTVKIIFRVSSHFGGNGGFGLFCTLSKECQPNCN
Crosslinks:
  • 16x18 (Thioether)
  • 29x34 (Thioether)
  • 31x38 (Thioether)
Cleavage recognition sites:
  • GG
>SBI_06989
Leader sequence: MQKDTDILGAWDEAELVELSEADVHGG
Core sequences:
  • TDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC
Crosslinks:
  • 24x28 (Thioether)
  • 30x33 (Thioether)
  • 34x37 (Thioether)
Cleavage recognition sites:
  • GG
Annotation changelog
MIBiG version Submitter Notes
1.2
  • Hidden contributor (ID: MMICHVHAHR3QYQ42VLNY35LY, no GDPR consent given).
  • Submitted
2.0
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Migrated from v1.4
2.1
  • Hidden contributor (ID: 3UOU7PODQJXIM6BEPUHHRRA5, no GDPR consent given).
  • Remove negative molecular mass
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.

No matches found.