Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0001229.1:
Cluster 1RiPP18631

BGC0001229, SBI_06990 alpha / SBI_06989 beta biosynthetic gene cluster from Streptomyces bingchenggensis. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: SBI-06990 A1
Molecular activity: Unknown

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lanthipeptide (cyclic)
Peptides in this cluster:
SBI_06990
RiPP core peptide sequence(s): TISPIDTVKIIFRVSSHFGGNGGFGLFCTLSKECQPNCN
Leader peptide length: 28
Follower peptide length: -1
Cleavage recognition site sequence(s): GG
Peptidase(s) involved in precursor cleavage: sbi_06987
Crosslinks in final product:
16=18 AA (Thioether)
29=34 AA (Thioether)
31=38 AA (Thioether)
SBI_06989
RiPP core peptide sequence(s): TDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC
Leader peptide length: 27
Follower peptide length: -1
Cleavage recognition site sequence(s): GG
Peptidase(s) involved in precursor cleavage: sbi_06987
Crosslinks in final product:
24=28 AA (Thioether)
30=33 AA (Thioether)
34=37 AA (Thioether)

Gene cluster description

SBI_06990 alpha / SBI_06989 beta (BGC0001229). Gene Cluster 1. Biosynthetic class = RiPP. GenBank CP002047, positions 8356685-8365315. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

SBI_06989 leader / core peptide, putative Class II
MQKDTDILGA - WDEAELVELDhaEADVHGGDhbDPAVDhbGLILGIVAIQAGVAVGVDhaAAFCPDhbDhbKCDhbDhaRC
SBI_06990 leader / core peptide, putative Class II
MHQEFEGDISLVEELAEQDLHDAAQHGGTISPIDTVKIIFRVSSHFG - GNGGFGLFCDhbLDhaKECQPNCN

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Sequence-based prediction
MIxS-compliance:Unknown
Comments:The protease encoded in the two component lanthipeptide cluster is fused with a second lanthionine synthetase, LanM in the same orf SBI_06987
Contact for this cluster:Mangal Singh (Panjab University )

Literature references

1. Singh M, Sareen D. (2014 TI) Novel LanT associated lantibiotic clusters identified by genome database mining. PLoS One 9(3):e91352. doi: 10.1371/journal.pone.0091352. eCollection