Lanthipeptide(s) for G339_RS0112025
G339_RS0112000
Leader:
MKRTLAVIVAA
Core:
AAAVGCVVAARVALASADRPGGKEPAKSSTSPVQPPNTGYWTPERMQSAKPAPMPDPDD
Core with dehydrations:
AAAVGCysVVAARVALADhaADRPGGKEPAKDhaDhaDhbDhaPVQPPNDhbGYWDhbPERMQDhaAKPAPMPDPDD
antiSMASH-DB 4.0 matches for G339_RS0112000
100.0%
Lanthipeptides: G339_RS0112000_lanthipeptide
1
AAAVGCVVAARVALASADRPGGKEPAKSSTSPVQPPNTGYWTPERMQSAKPAPMPDPDD
59
AAAVGCVVAARVALASADRPGGKEPAKSSTSPVQPPNTGYWTPERMQSAKPAPMPDPDD
1
AAAVGCVVAARVALASADRPGGKEPAKSSTSPVQPPNTGYWTPERMQSAKPAPMPDPDD
59
16.9%
Lanthipeptides: allorf_0722945_0723160_lanthipeptide
19
RPGGKEPAKSSTSPVQPPNTGYWTPERMQSAKPA
52
RP G P + + ++ TG PE + A+ A
7
RPAGASPRRFESCLLREECTGRGVPEWLIGARCA
40
15.3%
Lanthipeptides: SBI_RS34370_lanthipeptide
9
AARVALASADRPGGKEPAKS
28
A V L+ AD GG +PA +
4
AELVELSEADVHGGTDPAVT
23
allorf_18048_18182
Leader:
MSVTGRPAGTNRTSALPTHGECAENGDDAACVAA
Core:
PGSPDTVCRV
Core with dehydrations:
PGDhaPDDhbVCysRV
antiSMASH-DB 4.0 matches for allorf_18048_18182
19.2%
Lanthipeptides: B6F67_RS25205_lanthipeptide
1
PGSPDTVCRV
10
PG+ T+CR+
7
PGTCQTLCRI
16
12.2%
Lanthipeptides: allorf_110888_111058_lanthipeptide
3
SPDTVCRV
10
SPD CRV
20
SPDVGCRV
27
allorf_19175_19339
Leader:
MKYAFARLLMESWTVGLSGLRTASGHMKSFQVCMNVSRPRTPAAGRSAGS
Core:
TTCQ
Core with dehydrations:
DhbDhbCysQ
allorf_20422_20655
Leader:
MTSPKSRSKSWVNTIATAAVEVTSGATIPMRKNVLAFIRRSSSAA
Core:
TPSASRSCGTVESTKMPTVLTTACQKSGSWTR
Core with dehydrations:
DhbPDhaADhaRDhaCysGDhbVEDhaDhbKMPDhbVLDhbDhbACysQKDhaGDhaWDhbR
antiSMASH-DB 4.0 matches for allorf_20422_20655
21.9%
Lanthipeptides: allorf_2314001_2314195_lanthipeptide
3
SASRSCGTVES
13
S SR+CGT+ S
4
SGSRACGTIGS
14
18.2%
Lanthipeptides: SAUG_RS08760_lanthipeptide
9
GTVESTKMPTVLTTACQK
26
GTVE PT+ + AC +
2
GTVEPQATPTISSVACIR
19
12.5%
Lanthipeptides: allorf_4056428_4056634_lanthipeptide
15
KMPTVLTTACQKSGSWTR
32
++P + T Q+ G W+R
29
RVPQSVRTPHQEVGRWSR
46
allorf_21210_21431
Leader:
MLFATAGSCSACGEDGNVFLS
Core:
LNAPIWPCGLVRNSASSAASLGCLVCFGTASQEPPHEPPPPGMLAMSHLPLP
Core with dehydrations:
LNAPIWPCysGLVRNDhaADhaDhaAADhaLGCysLVCysFGDhbADhaQEPPHEPPPPGMLAMDhaHLPLP
antiSMASH-DB 4.0 matches for allorf_21210_21431
15.4%
Lanthipeptides: allorf_022261_022440_lanthipeptide
6
WPCGLVRNSASSAASLGCLVCFGTASQE
33
+ + R S + A++ CL F T Q+
3
FFTKITRTSIVNYATINCLAPFSTFPQQ
30
13.5%
Lanthipeptides: LC55x_RS27140_lanthipeptide
27
FGTASQEPPHE
37
FG A Q PP E
10
FGRAKQTPPEE
20
13.5%
Lassopeptides: GS397_RS04955_lassopeptide
27
FGTASQEPPHEPPPPGML
44
FG + + P + P PG+L
2
FGGSGADNPDQQPNPGIL
19
with 1 more sequence matches
11.9%
Lanthipeptides: allorf_039973_040194_lanthipeptide
5
IWPCGLVRNSASSAASLGC
23
IWPCG + GC
10
IWPCGHRTFTGEGVGRKGC
28
MIBiG 4.0 matches for allorf_21210_21431
17.3%
Lanthipeptide: cacaoidin
7
PCGL---VRNSASSAASLGC
23
PC + V S S+ AS GC
4
PCTIYASVSASISATASWGC
23
allorf_21492_21641
Leader:
MSRLSAVCHG
Core:
GVNTWKSEVSLFCSNFSVVSNAVFTAGLLSKTSLLDLSK
Core with dehydrations:
GVNDhbWKDhaEVDhaLFCysDhaNFDhaVVDhaNAVFDhbAGLLDhaKDhbDhaLLDLDhaK
antiSMASH-DB 4.0 matches for allorf_21492_21641
14.0%
Lanthipeptides: allorf_19664_19897_lanthipeptide
23
VFTAGLLSKTSLLD
36
+F+AGLL + L++
2
LFSAGLLGQEGLIE
15
allorf_22188_22376
Leader:
MRVTLPSDPPSSPPQAAAVAATSAARAAAAA
Core:
NRGPFRPLTRIASPSRSGGGGCGSAPTKERP
Core with dehydrations:
NRGPFRPLDhbRIADhaPDhaRDhaGGGGCysGDhaAPDhbKERP
antiSMASH-DB 4.0 matches for allorf_22188_22376
30.3%
Lanthipeptides: allorf_3189783_3190004_lanthipeptide
5
FRPLTRIASPSRSGGGGCGS
24
FRP R SPSR C S
12
FRPGVRRLSPSRDARRSCQS
31
22.6%
Lanthipeptides: EG886_RS06310_lanthipeptide
1
NRGPFRPLTRIASPS
15
N G F LT+ PS
12
NTGQFCTLTKECQPS
26
21.6%
Lanthipeptides: allorf_2301019_2301156_lanthipeptide
9
TRIASPSRSGGGGCGSAPTKERP
31
R+ S +GGG C P + P
13
MRLLSAVETGGGHCIRPPWRAAP
35
with 5 more sequence matches
21.2%
Lanthipeptides: FFI11_RS16965_lanthipeptide
20
GGCGSAPTKER
30
CGS PTK R
22
NACGSTPTKGR
32
20.9%
Lanthipeptides: allorf_0450693_0450881_lanthipeptide
10
RIASPSRSGGG
20
RIASP RSG G
1
RIASPCRSGIG
11
20.5%
Lanthipeptides: allorf_1753738_1753947_lanthipeptide
8
LTRIASPSRSGGGGCGSAPTKE
29
L R+ P+ S G GS PT+
4
LARVRCPAHSARPGLGSCPTRR
25
18.8%
Lanthipeptides: JHL18_RS24410_lanthipeptide
8
LTRIASPSRSGGGGC
22
+T +A PS++ G C
17
VTEVACPSKACTGYC
31
15.3%
Lanthipeptides: allorf_9037809_9038009_lanthipeptide
1
NRGPFRPLTRIASPSR
16
N GP RP R A P+R
45
NAGPLRPF-RAAEPAR
59
MIBiG 4.0 matches for allorf_22188_22376
16.1%
Lanthipeptide: birimositide
1
NRGPFRPLTRIASPS
15
N G + LT+ P+
14
NNGGWCTLTKECQPN
28
Legend:
Dha: Didehydroalanine
Dhb: Didehydrobutyrine