Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0001392.1:
Cluster 1RiPP121926

BGC0001392, pinensins biosynthetic gene cluster from Chitinophaga pinensis. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: pinensins

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Other

Gene cluster description

pinensins (BGC0001392). Gene Cluster 1. Biosynthetic class = RiPP. GenBank CP001699, positions 6791760-6813685. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

Cpin_5325 leader / core peptide, putative Class I
MKDNQVTQIKLSIDDLKIDSFVTSIDSEMNMR - LAGGLAGQDhaHPDhbHDhbVADhbDDEGHLCDhbDhbIICA

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Literature references

1. Glavina Del Rio T et al. (2010) Complete genome sequence of Chitinophaga pinensis type strain (UQM 2034). Stand Genomic Sci 2(1):87-95. doi: 10.4056/sigs.661199.