BGC0001474: thiopeptin biosynthetic gene cluster from Streptomyces tateyamensis
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
View antiSMASH-generated output
Download Cluster GenBank file
Download region SVG
Location: 24,523 - 52,894 nt. (total: 28,372 nt).
This entry is originally from NCBI GenBank PYBW01000040.1.

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
other genes
resistance
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
General
Compounds
Genes
RiPP
History
KnownClusterBlast
General information about the BGC
MIBiG accession BGC0001474
Short description thiopeptin biosynthetic gene cluster from Streptomyces tateyamensis
Status Minimal annotation: no
A minimal annotation only contains information on the BGC loci and one or more linked chemical product(s)

Completeness: complete
Whether the loci encodes everything needed for the pathway producing the compound(s)
Biosynthetic class(es)
  • RiPP (Thiopeptide)
Loci NCBI GenBank: PYBW01000040.1
Compounds
  • thiopeptin
Species Streptomyces tateyamensis [taxonomy]
References
Chemical products information
thiopeptin
Copy SMILES
C71H84N18O18S6
List of genes involved in compound(s) production
Identifiers Position Product Functions Evidence Extra
  • C7C46_13030
  • PYC80207.1
 24523 - 25527 (-) aminotransferase
copy AA seq
copy Nt seq
  • C7C46_13035
  • PYC80208.1
 25532 - 25966 (-) ester cyclase
copy AA seq
copy Nt seq
  • C7C46_13040
  • PYC80209.1
 26012 - 27214 (-) acyl-CoA dehydrogenase
copy AA seq
copy Nt seq
  • C7C46_13045
  • PYC80210.1
 27211 - 28086 (-) SAM-dependent methyltransferase
copy AA seq
copy Nt seq
  • C7C46_13050
  • PYC80211.1
 28083 - 28655 (-) hypothetical protein
copy AA seq
copy Nt seq
  • C7C46_13055
  • PYC80212.1
 28719 - 29729 (-) alpha/beta hydrolase
copy AA seq
copy Nt seq
  • C7C46_13060
  • PYC80213.1
 30219 - 30401 (+) hypothetical protein
copy AA seq
copy Nt seq
  • C7C46_13065
  • PYC80214.1
 30522 - 31256 (+) hypothetical protein
copy AA seq
copy Nt seq
  • C7C46_13070
  • PYC80215.1
 31253 - 33871 (+) hypothetical protein
copy AA seq
copy Nt seq
  • C7C46_13075
  • PYC80216.1
 33868 - 34869 (+) hypothetical protein
copy AA seq
copy Nt seq
  • C7C46_13080
  • PYC80217.1
 34875 - 35981 (+) hypothetical protein
copy AA seq
copy Nt seq
  • C7C46_13085
  • PYC80218.1
 35978 - 37579 (+) hypothetical protein
copy AA seq
copy Nt seq
  • C7C46_13090
  • PYC80219.1
 38958 - 41123 (+) hypothetical protein
copy AA seq
copy Nt seq
  • C7C46_13095
  • PYC80220.1
 41101 - 42459 (+) hypothetical protein
copy AA seq
copy Nt seq
  • C7C46_13100
  • PYC80221.1
 42435 - 43730 (+) hypothetical protein
copy AA seq
copy Nt seq
  • C7C46_13105
  • PYC80222.1
 43727 - 44953 (+) hypothetical protein
copy AA seq
copy Nt seq
  • C7C46_13110
  • PYC80223.1
 44941 - 47343 (+) hypothetical protein
copy AA seq
copy Nt seq
  • C7C46_13115
  • PYC80224.1
 47340 - 47843 (+) hypothetical protein
copy AA seq
copy Nt seq
  • C7C46_13120
  • PYC80225.1
 47843 - 49042 (+) hypothetical protein
copy AA seq
copy Nt seq
  • C7C46_13125
  • PYC80226.1
 49039 - 50385 (+) hypothetical protein
copy AA seq
copy Nt seq
  • C7C46_13130
  • PYC80227.1
  • tsrT
 50382 - 52103 (+) tryptophan 2-C-methyltransferase
copy AA seq
copy Nt seq
  • C7C46_13135
  • PYC80228.1
 52103 - 52894 (+) NAD(P)-dependent oxidoreductase
copy AA seq
copy Nt seq
RiPP-specific information
Subclass Thiopeptide
Cyclic? yes
Precursor genes
C7C46_13060
Leader sequence: MSAPTEIQNLGVVGLTGLDTDTLEISDYLDESLLDEHDLTVTM
Core sequences:
  • VASASCTTCICTCSCSS
Annotation changelog
MIBiG version Submitter Notes
1.4
  • Hidden contributor (ID: JW4IUWLB4KKWRZXPXDMX77W3, no GDPR consent given).
  • Submitted
2.0
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Migrated from v1.4
3.1
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Update chemical activity to schema version 2.11
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.