Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0001579.1:
Cluster 1RiPP18838

BGC0001579, duramycin biosynthetic gene cluster from Streptomyces cinnamoneus. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: duramycin
SMILES string: Copy to clipboard

Class-specific details

Biosynthetic class(es):
RiPP

Gene cluster description

duramycin (BGC0001579). Gene Cluster 1. Biosynthetic class = RiPP. GenBank NZ_MOEP01000024, positions 85466-94303. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

BLK03_RS04555 leader / core peptide, putative Class II
MTASILQSVVDADFRAALIENPAAFGASTAVLPTPVEQQDQASLDFWTKDIAATEAFA - CKQDhaCDhaFGPFDhbFVCDGNDhbK

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

Literature references

1. Huo L et al. (2017) Insights into the Biosynthesis of Duramycin. LID - e02698-16 [pii] LID - 10.1128/AEM.02698-16 [doi] Appl Environ Microbiol 83(3). pii: AEM.02698-16. doi: