Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0001660.1:
Cluster 1RiPP17887

BGC0001660, mathermycin biosynthetic gene cluster from Marinactinospora thermotolerans. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: mathermycin

Class-specific details

Biosynthetic class(es):
RiPP

Gene cluster description

mathermycin (BGC0001660). Gene Cluster 1. Biosynthetic class = RiPP. GenBank KY938841. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

ARW80050.1 leader / core peptide, putative Class II
MSMTMTLQQAVVDDEFRSVLLADPAAFGLSVESLPGA - VERQDHEAIEAFDhbEAVVADhaEIYACADhaDhbCDhaFGPFDhbIACDGDhbDhbK

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

Literature references

1. Chen E et al. (2017) Mathermycin, a Lantibiotic from the Marine Actinomycete Marinactinospora thermotolerans SCSIO 00652. LID - e00926-17 [pii] LID - 10.1128/AEM.00926-17 [doi] Appl Environ Microbiol 83(15). pii: AEM.00926-17. doi: