Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0001788.1:
Cluster 1RiPP111509

BGC0001788, suicin 65 biosynthetic gene cluster from Streptococcus suis. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: suicin 65

Class-specific details

Biosynthetic class(es):
RiPP

Gene cluster description

suicin 65 (BGC0001788). Gene Cluster 1. Biosynthetic class = RiPP. GenBank KU867868. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

sssA leader / core peptide, putative Class II
MKDNYELMNTIQEVSLEELDQIIGA - GKNGVFKDhbIDhaHECHMNDhaWQFLFDhbCCDha
sssA_ leader / core peptide, putative Class II
MKKDIELMSTIQEVSLEELDQIIGA - GKNGVFKDhbIDhaHECHMNDhaWQFLFDhbCCDha
sssA1 leader / core peptide, putative Class II
MNAKTNKEINYEAVATLQEVKIDDLDILLGG - AGHGVNDhbIDhaAECRWNDhaLQAIFDhbCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

Literature references

1. Vaillancourt K et al. (2015 TI) Purification and Characterization of Suicin 65, a Novel Class I Type B Lantibiotic Produced by Streptococcus suis. PLoS One 10(12):e0145854. doi: 10.1371/journal.pone.0145854.