BGC0002120: nocathioamide A biosynthetic gene cluster from Nocardia terpenica IFM 0706
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
View antiSMASH-generated output
Download Cluster GenBank file
Download region SVG
Location: 100,790 - 118,707 nt. (total: 17,918 nt).
This entry is originally from NCBI GenBank JABMCZ010000005.1.

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
other genes
resistance
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
General
Compounds
Genes
RiPP
History
KnownClusterBlast
General information about the BGC
MIBiG accession BGC0002120
Short description nocathioamide A biosynthetic gene cluster from Nocardia terpenica IFM 0706
Status Minimal annotation: no
A minimal annotation only contains information on the BGC loci and one or more linked chemical product(s)

Completeness: complete
Whether the loci encodes everything needed for the pathway producing the compound(s)
Biosynthetic class(es)
  • RiPP (Lanthipeptide)
Loci NCBI GenBank: JABMCZ010000005.1
Compounds
  • nocathioamide A
Species Nocardia terpenica IFM 0706 [taxonomy]
References
  • Improved . Buchmann A et al., Microbiol Resour Announc (2020) PMID:32816977
Chemical products information
nocathioamide A
Copy SMILES
C54H74N16O15S4
Chemical database entries
NPAtlas
List of genes involved in compound(s) production
Identifiers Position Product Functions Evidence Extra
  • HPY32_36370
  • NQE92404.1
 100790 - 102634 (-) TOMM precursor leader peptide-binding protein
copy AA seq
copy Nt seq
  • HPY32_36375
  • NQE92405.1
 102625 - 104478 (-) hypothetical protein
copy AA seq
copy Nt seq
  • HPY32_36380
  • NQE92406.1
 104681 - 105955 (-) GNAT family N-acetyltransferase
copy AA seq
copy Nt seq
  • HPY32_36385
  • NQE92407.1
 105955 - 106815 (-) hypothetical protein
copy AA seq
copy Nt seq
  • HPY32_36390
  • NQE92408.1
 106823 - 109315 (-) hypothetical protein
copy AA seq
copy Nt seq
  • HPY32_36395
  • NQE92409.1
 109309 - 110847 (-) SagB/ThcOx family dehydrogenase
copy AA seq
copy Nt seq
  • HPY32_36400
  • NQE92410.1
 110844 - 111425 (-) alpha/beta fold hydrolase
copy AA seq
copy Nt seq
  • HPY32_36405
  • NQE92411.1
 111429 - 112562 (-) methyltransferase domain-containing protein
copy AA seq
copy Nt seq
  • HPY32_36410
  • NQE92412.1
 112579 - 113844 (-) lanthionine synthetase C family protein
copy AA seq
copy Nt seq
  • HPY32_36415
  • NQE92413.1
 113963 - 114118 (-) hypothetical protein
copy AA seq
copy Nt seq
  • HPY32_36420
  • NQE92414.1
 114430 - 115710 (+) hypothetical protein
copy AA seq
copy Nt seq
  • HPY32_36425
  • NQE92415.1
 115703 - 116878 (+) YcaO-like family protein
copy AA seq
copy Nt seq
  • HPY32_36430
  • NQE92416.1
 116893 - 118077 (+) cytochrome P450
copy AA seq
copy Nt seq
  • HPY32_36435
  • NQE92417.1
 118240 - 118707 (+) GNAT family N-acetyltransferase
copy AA seq
copy Nt seq
RiPP-specific information
Subclass Lanthipeptide
Cyclic? yes
Precursor genes
HPY32_36415
Core sequences:
  • MKMMKRNEEVAESGYDDFDLNIIDSSMFDDESSRPAAPACHTLSSLPCCAN
Annotation changelog
MIBiG version Submitter Notes
3.0
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Entry added
  • Fix precursor gene ID
3.1
  • Hidden contributor (ID: AAAAAAAAAAAAAAAAAAAAAAAA, no GDPR consent given).
  • Changed chemical structures for compounds: nocathioamide A.
  • Added NPAtlas links to compounds: nocathioamide A.
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.

No matches found.