LOCUS BGC0002331 2106 bp DNA circular BCT 27-FEB-2015 DEFINITION Pseudomonas entomophila str. L48 chromosome,complete sequence. ACCESSION BGC0002331 VERSION BGC0002331 KEYWORDS . SOURCE Pseudomonas entomophila L48 ORGANISM Pseudomonas entomophila L48 Bacteria; Pseudomonadota; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas. REFERENCE 1 (bases 1 to 5888780) AUTHORS Vodovar,N., Vallenet,D., Cruveiller,S., Rouy,Z., Barbe,V., Acosta,C., Cattolico,L., Jubin,C., Lajus,A., Segurens,B., Vacherie,B., Wincker,P., Weissenbach,J., Lemaitre,B., Medigue,C. and Boccard,F. TITLE Complete genome sequence of the entomopathogenic and metabolically versatile soil bacterium Pseudomonas entomophila JOURNAL Nat. Biotechnol. 24 (6), 673-679 (2006) PUBMED 16699499 REMARK 1. Centre de Genetique Moleculaire, Centre National de la Recherche Scientifique, 91198 Gif-sur-Yvette, France. 2. Genoscope, Centre National de Sequencage and CNRS-UMR8030, 2 rue Gaston Cremieux, 91057 Evry Cedex, France. REFERENCE 2 (bases 1 to 5888780) AUTHORS Genoscope. TITLE Direct Submission JOURNAL Submitted (26-JUL-2006) Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr) COMMENT ##antiSMASH-Data-START## Version :: 8.dev-5707d64f Run date :: 2025-08-15 21:27:22 ##antiSMASH-Data-END## Annotation data relative to BLAST similarities, COG assignations, enzymatic function prediction (PRIAM software), TMHMM and SignalP predictions, and synteny results (Syntonizer software) are available in EntomoScope database via the MaGe annotation system http://www.genoscope.cns.fr/agc/mage. Each annotation includes a confidence level as follow: 1 : Function experimentally demonstrated in the studied organism 2a : Function of homologous gene experimentally demonstrated in an other organism 2b : Function of strongly homologous gene 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology 4 : Homologs of previously reported genes of unknown function 5 : No homology to any previously reported sequences 6 : Doubtful CDS 7 : Gene remnant. FEATURES Location/Qualifiers region 1..2106 /contig_edge="True" /product="unknown" /region_number="1" /subregion_numbers="1" /tool="antismash" subregion 1..2106 /aStool="externally annotated by: MIBiG" /contig_edge="True" /label="BGC0002331" /subregion_number="1" /tool="antismash" gene 1..1059 /locus_tag="PSEEN2785" CDS 1..1059 /codon_start=1 /db_xref="EnsemblGenomes-Gn:PSEEN2785" /db_xref="EnsemblGenomes-Tr:CAK15564" /db_xref="GOA:Q1I9V9" /db_xref="InterPro:IPR000182" /db_xref="InterPro:IPR016181" /db_xref="UniProtKB/TrEMBL:Q1I9V9" /inference="ab initio prediction:AMIGene:2.0" /locus_tag="PSEEN2785" /note="Evidence 5 : No homology to any previously reported sequences" /product="hypothetical protein" /protein_id="CAK15564.1" /transl_table=11 /translation="MTSTTVLHKSVSTPVDIETRTDAFDYRPGHINDIPRLAQLFQSVY GQTTHPCQSPGYIRSSMDSGQQQWFVAELDSFLVGCCCVARRPWNQSWEMSHGVVHPAA RRTGAISNLVRLGLERHRPHAMELGFYVTRNIASHALMKKIRPGVLVGHDGGPDKVDDI REYHLTALLPPAQEGFVHVAPGYAHNDVAGPIIARLYDALRLTPQPGAYPATCLSGPPG AQVHGPLRFNHEPGADALMVSGQVGDNPTQQATLQALTALLQRHPQVQYFSVHILADKL ELLAGLVGLGFAITAYLPAWHLEGGVRYDCILLVFEVFADAPRSHGFDDEVAFFDQAYA KLADSLCAIALQ" gene 1123..2106 /locus_tag="PSEEN2786" CDS 1123..2106 /codon_start=1 /db_xref="EnsemblGenomes-Gn:PSEEN2786" /db_xref="EnsemblGenomes-Tr:CAK15565" /db_xref="GOA:Q1I9V8" /db_xref="InterPro:IPR005804" /db_xref="UniProtKB/TrEMBL:Q1I9V8" /gene_functions="biosynthetic-additional (rule-based-clusters) delta12_cd03507" /gene_kind="biosynthetic-additional" /inference="ab initio prediction:AMIGene:2.0" /locus_tag="PSEEN2786" /note="Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type e : enzyme" /product="putative fatty acid desaturase" /protein_id="CAK15565.1" /sec_met_domain="delta12_cd03507 (E-value: 4.5e-33, bitscore: 101.7, seeds: 49, tool: rule-based-clusters)" /transl_table=11 /translation="MTKDQWLVVRKQIPDGAKEPWTVMLWVADLLLLVLAWNFWLSEST ALQVLGLLVAGLATVQLYLILHEALHGATSDNRRLNDIIGHFNGWLIALPFLVRRRFHM AHHTWTAHPLNDPENRGMIERFAVMTKKQERTLEFMWKHWLPMIAVNHFLLNWRAPFIA RAQGDDSPRILKEIRFARLYLVGYGVVAAVAWAFGHLADLALFYLIIWLFLALIVELVN LPHHAEAPLLAKDGERLQFWEQDRVSHDCKSVPVWSRFVILNFNLHIVHHAFPSVPWYR LPEAHRMLHEQDGSPAASQLNEWDFSRKNRRRPLLKLMGHFFDHRA" ORIGIN 1 atgacctcga ccaccgtgct gcataagtcc gtttccacgc ccgtggatat cgagacgcgt 61 accgacgcct ttgattaccg cccaggccat atcaacgata ttcctcgact cgcccagttg 121 ttccaaagcg tctacgggca aaccacccac ccttgccaaa gcccgggcta tatccgcagt 181 tcaatggact ccgggcaaca acaatggttt gtcgccgaac tcgacagctt tcttgtcggt 241 tgctgttgtg tcgctcggcg cccgtggaac cagtcctggg aaatgtccca tggcgtggtc 301 cacccggccg cacgcagaac cggggcgatt tccaacctgg tcagactggg actggagcgc 361 catcggccac acgccatgga gttgggtttc tacgtcacgc gcaacattgc aagccatgcc 421 ttgatgaaga agatcaggcc aggcgtgctg gtggggcacg acggcgggcc ggacaaggtc 481 gacgacatca gggagtacca cctgaccgcc ctgctccccc cggcgcagga aggtttcgtg 541 catgtcgcgc cggggtacgc gcataacgac gtggccggcc cgatcatcgc caggctgtac 601 gatgcactgc ggctcacccc acagcccggc gcctacccgg ccacttgcct gagcggccca 661 cccggtgcgc aagtgcacgg cccgttgcgc ttcaaccatg agccgggggc cgacgcactg 721 atggtgtccg gccaggtcgg cgacaacccg acgcagcaag cgacgctgca ggcactcact 781 gccctcctcc agcgccatcc ccaggtgcag tacttcagcg tgcatatcct cgccgacaag 841 ctggaactgc tcgccggcct ggtcggcctt ggctttgcga tcactgccta cctgccggcc 901 tggcacctgg agggcggtgt tcgctacgac tgcatcctgc tggtcttcga agtattcgcc 961 gacgcccctc gcagccatgg cttcgatgat gaggtggcgt tcttcgacca ggcctacgcg 1021 aagttggccg acagcctctg cgccatcgcc ctgcaatgaa agcgcctctt acctaccgtg 1081 cattcccatc ccgcaacgga tgaagactgg agtattcaga caatgacaaa agaccaatgg 1141 ctcgttgtac gcaaacagat ccccgatggc gcgaaagagc cctggaccgt gatgttgtgg 1201 gttgccgacc tgctgctgct ggtgctggcg tggaacttct ggctgagtga atccaccgca 1261 ttgcaggttc taggcctgct ggtcgcgggc ctggccactg tgcagctgta cctgatcctg 1321 cacgaagccc tgcatggcgc gacctcggac aatcgccggc tcaacgacat catcggccac 1381 ttcaacggct ggttgatcgc cctgccgttc ctggttcgcc gacgcttcca catggcccac 1441 cacacctgga ccgcacaccc gctcaatgac ccggaaaacc gcgggatgat cgagcgcttc 1501 gcggtcatga ccaagaagca ggaacgcacc ctggagttca tgtggaagca ctggctacca 1561 atgatcgccg tcaaccattt cctgctgaac tggcgtgcgc cgttcattgc ccgggcccaa 1621 ggtgacgact cgccgcgcat cctcaaggag attcgtttcg cccgcttgta cctggtgggt 1681 tacggggtgg tggcggccgt tgcctgggct ttcggtcatc tggcggacct ggcgctgttc 1741 tatctgatca tctggctgtt cctggccctg atcgtggaac tggtcaacct gcctcaccac 1801 gccgaggccc cgctgctggc gaaagatggc gagcgtttgc agttctggga acaggaccgc 1861 gtttcgcacg attgcaagag tgtgccggtg tggtcgcgct tcgtcatcct caacttcaac 1921 ctgcacatcg tgcaccacgc cttcccctcg gtgccttggt accggttgcc cgaggcacat 1981 cggatgctgc acgagcagga tggtagccca gcggcgtcgc agctcaatga gtgggacttc 2041 tccaggaaga atcgccgcag gccgctgctg aaactgatgg gtcatttctt cgaccatcgc 2101 gcctga //