Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000474.1:
Cluster 1RiPP112600

BGC0000474, microcyclamide biosynthetic gene cluster from Microcystis aeruginosa. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: microcyclamide
PubChem ID: 10555282
SMILES string: Copy to clipboard
Molecular formula: C26H30N8O4S2
Average molecular mass: 582.698 Da
Molecular activity: Unknown

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Cyanobactin (cyclic)
Peptides in this cluster:
CAP64339
RiPP core peptide sequence(s): MRITPMDKKNLLPNQGAPVIRGISGKLPSHLAELSEEALGGNGAEASATVSICAFDGAEASFTGCMCAFDGAEASITGCICAFDGAEASITGCICAFDGDEA
Leader peptide length: 41
Follower peptide length: -1
Cleavage recognition site sequence(s): GAEAS, AFDGAEAS, AFDGAEAS, AFDGAEAS, AFDGDEA
Peptidase(s) involved in precursor cleavage: cap64335, cap64342

Gene cluster description

microcyclamide (BGC0000474). Gene Cluster 1. Biosynthetic class = RiPP. GenBank AM931579. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Homologous known gene clusters

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Sequence-based prediction
MIxS-compliance:Unknown
Contact for this cluster:Nadine Ziemert (University of Tuebingen)

Literature references

1. Ziemert N et al. (2008) Microcyclamide biosynthesis in two strains of Microcystis aeruginosa: from structure to genes and vice versa. Appl Environ Microbiol 74(6):1791-7. doi: 10.1128/AEM.02392-07. Epub