Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000504.1:
Cluster 1RiPP17500

BGC0000504, cytolysin ClyLl / cytolysin ClyLs biosynthetic gene cluster from Enterococcus faecalis. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: cytolysin ClyLl

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lanthipeptide

Gene cluster description

cytolysin ClyLl / cytolysin ClyLs (BGC0000504). Gene Cluster 1. Biosynthetic class = RiPP. GenBank L37110. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

clyLl leader / core peptide, putative Class II
MENLSVVPSFEELSVEEMEAIQGS - GDVQAEDhbDhbPVCAVAADhbAAADhaDhaAACGWVGGGIFDhbGVDhbVVVDhaLKHC
clyLs leader / core peptide, putative Class II
MLNKENQENYYSNKLELVGPSFEELSLEEMEAIQGS - GDVQAEDhbDhbPACFDhbIGLGVGALFDhaAKFC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Literature references

1. Gilmore MS et al. (1994) Genetic structure of the Enterococcus faecalis plasmid pAD1-encoded cytolytic toxin system and its relationship to lantibiotic determinants. J Bacteriol 176(23):7335-44.