Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000519.1:
Cluster 1RiPP16400

BGC0000519, labyrinthopeptin A1,A3 / labyrinthopeptin A2 biosynthetic gene cluster from Actinomadura namibiensis. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: Labyrinthopeptin A2
Molecular formula: C85H110N20O24S4
Exact molecular mass: 1922.6872 Da (None)
Molecular activity: Other

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lantipeptide (cyclic)
Peptides in this cluster:
C0MP60
RiPP core peptide sequence(s): MASILELQNLDVEHARGENRSDWSLWECCSTGSLFACC
Leader peptide length: 20
Follower peptide length: -1
Peptidase(s) involved in precursor cleavage:
Crosslinks in final product:
4=8 AA (Thioether)
9=18 AA (Other)
13=17 AA (Thioether)
C0MP59
RiPP core peptide sequence(s): MASILELQDLEVERASSAADSNASVWECCSTGSWVPFTCC
Leader peptide length: 18
Follower peptide length: -1
Peptidase(s) involved in precursor cleavage:
Crosslinks in final product:
5=9 AA (Thioether)
10=21 AA (Other)
14=20 AA (Thioether)

Gene cluster description

labyrinthopeptin A1,A3 / labyrinthopeptin A2 (BGC0000519). Gene Cluster 1. Biosynthetic class = RiPP. GenBank FN178622. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

labA1 leader / core peptide, putative Class III
MASILELQDLEVERASSAAD - DhaNADhaVWECCDhaDhbGDhaWVPFDhbCC
labA2 leader / core peptide, putative Class III
MASILELQNLDVEHARGENR - DhaDWDhaLWECCDhaDhbGDhaLFACC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Enzymatic assays, Sequence-based prediction
MIxS-compliance:Unknown
Contact for this cluster:Daniel Petras (TU Berlin / AK Suessmuth)

Literature references

1. Meindl K et al. (2010) Labyrinthopeptins: a new class of carbacyclic lantibiotics. Angew Chem Int Ed Engl 49(6):1151-4. doi: 10.1002/anie.200905773.