Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000546.1:
Cluster 1RiPP17976

BGC0000546, SAL-2242 biosynthetic gene cluster from Streptomyces albus. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: SAL-2242
Exact molecular mass: 2242.22 Da ([M+H]+)
Molecular activity: Unknown

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lantipeptide (cyclic)
Peptides in this cluster:
SSHG_03589/WP_003950016.1
RiPP core peptide sequence(s): TGSQISLLICEYSSLSVTLCTP
Leader peptide length: 21
Follower peptide length: -1
Peptidase(s) involved in precursor cleavage:
Crosslinks in final product:
3=10 AA (Thioether)
13=20 AA (Thioether)

Gene cluster description

SAL-2242 (BGC0000546). Gene Cluster 1. Biosynthetic class = RiPP. GenBank NZ_DS999645, positions 4112717-4120692. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

SSHG_03589 leader / core peptide, putative Class III
MAVVRPLDTKEYVMALLDLQAMDTPQEEAVGDLAT - GDhaQIDhaLLICEYDhaDhaLDhaVDhbLCDhbP

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

General MIBiG information on this cluster

Complete gene cluster sequence?complete
Evidence for cluster-compound connection:Sequence-based prediction
MIxS-compliance:Unknown
Comments:AmfS-like classIII lanthipeptide
Contact for this cluster:Neha Garg (University of California at San Diego)

Literature references

1. Kersten RD et al. (2011) A mass spectrometry-guided genome mining approach for natural product peptidogenomics. Nat Chem Biol 7(11):794-802. doi: 10.1038/nchembio.684.