Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0001311.1:
Cluster 1RiPP115400

BGC0001311, flavecin biosynthetic gene cluster from Ruminococcus flavefaciens. Locus 1. Full MIBiG entry.

Chemical compounds

Compound: Flavecins
Molecular activity: Antibacterial

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lanthipeptide (cyclic)
Peptides in this cluster:
RUMFLAFD1_RS0111140
RiPP core peptide sequence(s): ASTVNTVGIHTTYLISKGLQNCPLKPTTILPILPRK
Leader peptide length: 27
Cleavage recognition site sequence(s): GG
Peptidase(s) involved in precursor cleavage: rumflafd1_rs0111200
Crosslinks in final product:
15=21 AA (Thioether)
RUMFLAFD1_RS0111175
RiPP core peptide sequence(s): GWKQTIVCTIAQGTVGCLVSYGLGNGGYCCTYTVECSKTCNK
Leader peptide length: 38
Cleavage recognition site sequence(s): GA
Peptidase(s) involved in precursor cleavage: rumflafd1_rs0111200
Crosslinks in final product:
14=17 AA (Thioether)
20=30 AA (Thioether)
31=36 AA (Thioether)
33=40 AA (Thioether)
RUMFLAFD1_RS0111195
RiPP core peptide sequence(s): TSSIDCVRLASNTPEGTVNLTVRIEFCPSAACTYSCRL
Leader peptide length: 27
Recognition motif in leader peptide for modification: GG
Peptidase(s) involved in precursor cleavage: rumflafd1_rs0111200
Crosslinks in final product:
2=6 AA (Thioether)
21=27 AA (Thioether)
29=32 AA (Thioether)
33=36 AA (Thioether)
RUMFLAFD1_RS0111170
RiPP core peptide sequence(s): ASTLPCAEVVVTVTGIIVKATTGFDWCPTGACTHSCRF
Leader peptide length: 34
Cleavage recognition site sequence(s): GA
Peptidase(s) involved in precursor cleavage: rumflafd1_rs0111200
Crosslinks in final product:
2=6 AA (Thioether)
21=27 AA (Thioether)
29=32 AA (Thioether)
33=36 AA (Thioether)
RUMFLAFD1_RS0111165
RiPP core peptide sequence(s): VGYTTYWGILPLVTKNPQICPVSENTVKCRLL
Leader peptide length: 27
Cleavage recognition site sequence(s): GA
Peptidase(s) involved in precursor cleavage: rumflafd1_rs0111200
Crosslinks in final product:
14=20 AA (Thioether)
26=29 AA (Thioether)
RUMFLAFD1_RS0111160
RiPP core peptide sequence(s): ASSIPCAKVVVKVTTVVVAATTGFDWCPTGACTTSCRF
Leader peptide length: 34
Cleavage recognition site sequence(s): GA
Peptidase(s) involved in precursor cleavage: rumflafd1_rs0111200
Crosslinks in final product:
2=6 AA (Thioether)
21=27 AA (Thioether)
29=32 AA (Thioether)
33=36 AA (Thioether)
RUMFLAFD1_RS0111155
RiPP core peptide sequence(s): GSTIQCVNTTIGTILSVVFDCCPTSACTPPCRF
Leader peptide length: 31
Cleavage recognition site sequence(s): GA
Peptidase(s) involved in precursor cleavage: rumflafd1_rs0111200
Crosslinks in final product:
2=6 AA (Thioether)
13=21 AA (Thioether)
16=22 AA (Thioether)
24=27 AA (Thioether)
28=31 AA (Thioether)
RUMFLAFD1_RS0111150
RiPP core peptide sequence(s): GSSNDCADLILKITGVVVSATSKFDWCPTGACTTSCRF
Leader peptide length: 33
Cleavage recognition site sequence(s): GA
Peptidase(s) involved in precursor cleavage: rumflafd1_rs0111200
Crosslinks in final product:
2=6 AA (Thioether)
21=27 AA (Thioether)
29=32 AA (Thioether)
33=36 AA (Thioether)
RUMFLAFD1_RS0111145
RiPP core peptide sequence(s): GSPLTVTITGLIVAATTGFDWCPTGACTYSCRV
Leader peptide length: 34
Cleavage recognition site sequence(s): GA
Peptidase(s) involved in precursor cleavage: rumflafd1_rs0111200
Crosslinks in final product:
16=22 AA (Thioether)
24=27 AA (Thioether)
28=31 AA (Thioether)

Gene cluster description

flavecin (BGC0001311). Gene Cluster 1. Biosynthetic class = RiPP. GenBank NZ_ACOK01000098, positions 5724-8798. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

RUMFLAFD1_RS0111140 leader / core peptide, putative Class II
MSEKNMEKAGVVKADELDEMIDETTGGA - DhaDhbVNDhbVGIHDhbDhbYLIDhaKGLQNCPLKPDhbDhbILPILPRK
RUMFLAFD1_RS0111145 leader / core peptide, putative Class II
MDNNTKLQKLYEQLAATGSEKELDAMLDENMAGA - GDhaPLDhbVDhbIDhbGLIVAADhbDhbGFDWCPDhbGACDhbYDhaCRV
RUMFLAFD1_RS0111150 leader / core peptide, putative Class II
MENKFDMEKFKKLAAVVSEDELDTLLDETTVGA - GDhaDhaNDCADLILKIDhbGVVVDhaADhbDhaKFDWCPDhbGACDhbDhbDhaCRF
RUMFLAFD1_RS0111155 leader / core peptide, putative Class II
MDNNTEKFNELAAIADESELNEMLDENITGA - GDhaDhbIQCVNDhbDhbIGDhbILDhaVVFDCCPDhbDhaACDhbPPCRF
RUMFLAFD1_RS0111160 leader / core peptide, putative Class II
MNNKEFNMEQFKKLAAVVSEDELDEMLDENVTGA - ADhaDhaIPCAKVVVKVDhbDhbVVVAADhbDhbGFDWCPDhbGACDhbDhbDhaCRF
RUMFLAFD1_RS0111165 leader / core peptide, putative Class II
MEKMNNIAGITPENELDEMFDDSVVGA - VGYDhbDhbYWGILPLVDhbKNPQICPVDhaENDhbVKCRLL
RUMFLAFD1_RS0111170 leader / core peptide, putative Class II
MNNNNFDMEKFKKLAAIVSEGEIDEMLDETTVGA - ADhaDhbLPCAEVVVDhbVDhbGIIVKADhbDhbGFDWCPDhbGACDhbHDhaCRF
RUMFLAFD1_RS0111175 leader / core peptide, putative Class II
MACGNVAAELDENSQALDAINGA - GWKQDhbIVCDhbIAQGDhbVGCLVDhaYGLGNGGYCCDhbYDhbVECDhaKDhbCNK
RUMFLAFD1_RS0111180 leader / core peptide, putative Class II
MACGNVAAELDENSQALDAINGA - GWKQDhbIVCDhbIAQGDhbVGCLVDhaYGLGNGGYCCDhbYDhbVECDhaKDhbCNK
RUMFLAFD1_RS0111185 leader / core peptide, putative Class II
MACGNVAAELDENSQALDAINGA - GWKQDhbIACDhbIAQGDhbLGCLVDhaYGLGNGGYCCDhbYDhbVECDhaKDhbCNK
RUMFLAFD1_RS0111190 leader / core peptide, putative Class II
MACGNVAAELDENSQALDAINGA - GWKQDhbIVCDhbIAQGDhbVGCLVDhaYGLGNGGYCCDhbYDhbVECDhaKDhbCNK
RUMFLAFD1_RS0111195 leader / core peptide, putative Class II
MERYGHLAGVIPVDEIDDMFESNVIGG - DhbDhaDhaIDCVRLADhaNDhbPEGDhbVNLDhbVRIEFCPDhaAACDhbYDhaCRL

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

General MIBiG information on this cluster

Complete gene cluster sequence?unknown
Evidence for cluster-compound connection:Heterologous expression
MIxS-compliance:Unknown
Contact for this cluster:Wilfred A. Van Der Donk (University of Illinois at Urbana-Champaign)

Literature references

1. Zhao X, van der Donk WA. (2016) Structural Characterization and Bioactivity Analysis of the Two-Component Lantibiotic Flv System from a Ruminant Bacterium. Cell Chem Biol 23(2):246-256. doi: 10.1016/j.chembiol.2015.11.014.