BGC0001494 - 1 region(s) - antiSMASH results

BGC0001494 (Acinetobacter gyllenbergii CIP 110306 = MTCC 11365)

Region	Type	From	To	Most similar known cluster		Similarity
Region 1	lassopeptide	1	5,185

BGC0001494 - Region 1 - lassopeptide

Download region SVG

Location: 1 - 5,185 nt. (total: 5,185 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG

MIBiG comparison

KnownClusterBlast

Lasso peptides

External annotation

Name		MIBiG
Version		3.0

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001494.1	1.00	RiPP	acinetodin	Acinetobacter gyllenbergii CIP 110306
BGC0000571.1	0.32	RiPP	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001645.1	0.24	RiPP	lagmysin	Streptomyces sp. NRRL S-118
BGC0001550.1	0.23	RiPP	citrulassin D	Streptomyces katrae
BGC0001549.1	0.23	RiPP	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001634.1	0.23	RiPP	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000581.1	0.22	RiPP	microcin J25	Escherichia coli
BGC0000575.1	0.22	RiPP	lariatin	Rhodococcus jostii
BGC0001552.1	0.22	RiPP	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001176.1	0.22	RiPP	streptomonomicin	Streptomonospora alba

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001494.1	1.00	RiPP	acinetodin	Acinetobacter gyllenbergii CIP 110306
BGC0000571.1	0.65	RiPP	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001645.1	0.57	RiPP	lagmysin	Streptomyces sp. NRRL S-118
BGC0001550.1	0.57	RiPP	citrulassin D	Streptomyces katrae
BGC0001549.1	0.57	RiPP	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001634.1	0.56	RiPP	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000581.1	0.56	RiPP	microcin J25	Escherichia coli
BGC0000575.1	0.55	RiPP	lariatin	Rhodococcus jostii
BGC0001552.1	0.55	RiPP	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001176.1	0.55	RiPP	streptomonomicin	Streptomonospora alba

Similar known gene clusters

No matches found.

Lasso peptide predictions

F957_01368

Leader:

MKNLNKMFKKEQKYHKQLKVISVKGSASKMTL

Full core:

GGKGPIFETWVTEGNYYG

Putative macrolactam:

GGKGPIFE

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lasso peptides

Core peptide predictions

F957_01368 - Class II: Cleavage pHMM score: -0.20; RODEO score: 27; Monoisotopic mass: 1955.9 Da; Molecular weight: 1957.1 Da; Number of bridges: 0