Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0001669.1:
Cluster 1RiPP140001

BGC0001669, microvionin biosynthetic gene cluster from Microbacterium arborescens. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: microvionin

Class-specific details

Biosynthetic class(es):
RiPP

Gene cluster description

microvionin (BGC0001669). Gene Cluster 1. Biosynthetic class = RiPP. GenBank MG673929, positions 1-40001. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

lanA leader / core peptide, putative Class II
MITTHDQEMTIISPRWDMAARSTDGSTPSVQAQIDAEFERVVSPYM - ADhaDhaGWLCDhbLDhbIECGDhbLICACR
micA leader / core peptide, putative Class II
MSLEQLEALDASSEAAEMAASLGS - QDhaC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Homologous known gene clusters

Literature references

1. Wiebach V et al. (2018) The anti-staphylococcal lipolanthines are ribosomally synthesized lipopeptides. Nat Chem Biol 14(7):652-654. doi: 10.1038/s41589-018-0068-6. Epub 2018