BGC0002074 - 1 region(s) - antiSMASH results

BGC0002074 (Streptomyces huasconensis)

Region	Type	From	To	Most similar known cluster		Similarity
Region 1	lassopeptide	1	2,630	anantin C	RiPP	75%

BGC0002074 - Region 1 - lassopeptide

Download region SVG

Location: 1 - 2,630 nt. (total: 2,630 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG

MIBiG comparison

KnownClusterBlast

Lasso peptides

External annotation

Name		MIBiG
Version		3.0

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002074.1	0.83	RiPP	huascopeptin	Streptomyces huasconensis
BGC0002053.1	0.37	RiPP	ulleungdin	Streptomyces sp.
BGC0001507.1	0.37	RiPP	anantin C	Streptomyces olindensis
BGC0001307.1	0.36	RiPP	chaxapeptin	Streptomyces leeuwenhoekii
BGC0001539.1	0.35	RiPP	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001673.1	0.35	RiPP	moomysin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001548.1	0.34	RiPP	citrulassin A	Streptomyces albulus
BGC0001781.1	0.33	RiPP	sphaericin	Planomonospora sphaerica
BGC0001889.1	0.32	RiPP	fusilassin	Thermobifida fusca YX
BGC0001552.1	0.31	RiPP	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002074.1	0.94	RiPP	huascopeptin	Streptomyces huasconensis
BGC0002053.1	0.70	RiPP	ulleungdin	Streptomyces sp.
BGC0001507.1	0.70	RiPP	anantin C	Streptomyces olindensis
BGC0001307.1	0.69	RiPP	chaxapeptin	Streptomyces leeuwenhoekii
BGC0001539.1	0.68	RiPP	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001673.1	0.68	RiPP	moomysin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001548.1	0.67	RiPP	citrulassin A	Streptomyces albulus
BGC0001781.1	0.67	RiPP	sphaericin	Planomonospora sphaerica
BGC0001889.1	0.65	RiPP	fusilassin	Thermobifida fusca YX
BGC0001552.1	0.65	RiPP	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893

Similar known gene clusters

Lasso peptide predictions

hptA

Leader:

MYEQELKEEFTAQDYVPPMLAEVGEFSEDTL

Full core:

GYGNAWDSKNGLF

Putative macrolactam:

GYGNAWD

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lasso peptides

Core peptide predictions

hptA - Class II: Cleavage pHMM score: 3.90; RODEO score: 21; Monoisotopic mass: 1409.6 Da; Molecular weight: 1410.5 Da; Number of bridges: 0